DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and PTPRQ

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_016874762.1 Gene:PTPRQ HGNCID:9679 Length:2536 Species:Homo sapiens

Alignment Length:348 Identity:67/349 (19%)
Similarity:121/349 (35%) Gaps:109/349 (31%)


  Fly   203 VTAKTQFG-----YLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIA 262
            :.|:|..|     .::|..||::..::....:...|...:.:..:....|..||...|   .::.
Human   596 IAAETSAGTGPKSNISVFTPPDVPGAVFDLQLAEVESTQVRITWKKPRQPNGIINQYR---VKVL 657

  Fly   263 INKNHIV---------NEWEGDTL--EITRISRLDMGAYLCIAS-------------NGVP---- 299
            :.:..|:         ||:..|.:  ||..|....:|.|...|.             |..|    
Human   658 VPETGIILENTLLTGNNEYINDPMAPEIVNIVEPMVGLYEGSAEMSSDLHSLATFIYNSHPDKNF 722

  Fly   300 -----------PTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIE---CFTEAHPTSLNYWT-R 349
                       |.|:.|.:...|.            |.|..:..|.   .||| |..|::.:| .
Human   723 PARNRAEDQTSPVVTTRNQYITDI------------AAEQLSYVIRRLVPFTE-HMISVSAFTIM 774

  Fly   350 GEGP--IIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSY 412
            ||||  ::....:.:|.:::.:..||        |:||....:|....:.|.|:    |..|..|
Human   775 GEGPPTVLSVRTRQQVPSSIKIINYK--------NISSSSILLYWDPPEYPNGK----ITHYTIY 827

  Fly   413 PPTTASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKNTRYQ------SNLNEIGLSEQKS 471
            .....::..:...|      |:|::...|         ..|.|:|:      :::.|..|||:..
Human   828 AMELDTNRAFQITT------IDNSFLITG---------LKKYTKYKMRVAASTHVGESSLSEEND 877

  Fly   472 FLDKTQNPLLANGNANEADAESN 494
            ...:|          :|.:.||:
Human   878 IFVRT----------SEDEPESS 890

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 4/18 (22%)
Ig 130..200 CDD:143165
I-set 226..310 CDD:254352 20/123 (16%)
IGc2 233..298 CDD:197706 16/89 (18%)
Ig 313..410 CDD:299845 24/103 (23%)
IG_like 325..410 CDD:214653 24/91 (26%)
PTPRQXP_016874762.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.