DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Tmigd1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001128501.1 Gene:Tmigd1 RGDID:1307444 Length:261 Species:Rattus norvegicus

Alignment Length:200 Identity:47/200 (24%)
Similarity:81/200 (41%) Gaps:36/200 (18%)


  Fly   152 SAILTVHNHV----------ITRNPRISVTHDKHDRHRTWY------------------LHINNV 188
            |::|||:...          |..:...:|.:...|....||                  :.::.:
  Rat    27 SSVLTVNGRTEDYILDTYYGIQASLECAVQNHTRDEELLWYREAGRVDLKNGNKINTSSVCVSPI 91

  Fly   189 HEEDRG-RYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIK 252
            :|.|.| .:.|::......:....|||..||.:.   .:....|.||:::.|.|....:|:..:.
  Rat    92 NESDNGVSFTCKLQRDQTVSITVVLNVTFPPLLS---GNGFQTVEEGSDVRLVCNVKSNPQAQML 153

  Fly   253 WKRDDNSRIAINK--NHIVNEWEGDTLEITRISRLDMGAYLCIASNGV-PPTVSKRIKVSVDFPP 314
            |.| :||.:.:.|  :.|....|...|.|||:.:.|.|.|.||||:.: ..|:...:.|....|.
  Rat   154 WYR-NNSALVLEKGRHQIQQTRESFQLSITRVKKSDNGTYNCIASSSLKTETMDFHLVVKDKVPV 217

  Fly   315 MLLIP 319
            |.:.|
  Rat   218 MPIEP 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 16/93 (17%)
Ig 130..200 CDD:143165 13/77 (17%)
I-set 226..310 CDD:254352 26/87 (30%)
IGc2 233..298 CDD:197706 23/67 (34%)
Ig 313..410 CDD:299845 3/7 (43%)
IG_like 325..410 CDD:214653
Tmigd1NP_001128501.1 IG_like 130..211 CDD:214653 25/82 (30%)
Ig 138..204 CDD:143165 21/67 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.