DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Lac

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster

Alignment Length:304 Identity:87/305 (29%)
Similarity:152/305 (50%) Gaps:22/305 (7%)


  Fly   117 EYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAI-LTVHNHVITRNPRISVTHDKHDRHRT 180
            |.|:::    |..|:..|||:....|.|.::..:...: |:..:.::.::.|.|:.:|.:.  .|
  Fly    37 EQIKDI----GGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNS--ST 95

  Fly   181 WYLHINNVHEEDRGRYMCQ-----INTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLR 240
            :.|.|.::.|.|.|.|.||     ::.|:|:.:   |:|..||.|.|: |:..|:..||:.:.:.
  Fly    96 YKLQIKDIQETDAGTYTCQVVISTVHKVSAEVK---LSVRRPPVISDN-STQSVVASEGSEVQME 156

  Fly   241 CRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKR 305
            |.|||.|.|.|.|:|::|:.:..:....|    |:||.|..:.:.|.|.|.|:|.|||.....:.
  Fly   157 CYASGYPTPTITWRRENNAILPTDSATYV----GNTLRIKSVKKEDRGTYYCVADNGVSKGDRRN 217

  Fly   306 IKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLP 370
            |.|.|:|.|::.:|...:|....:::.:||..||:|.....||:.:..:.::.| |.:.......
  Fly   218 INVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQH-YSISHFATAD 281

  Fly   371 AYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPP 414
            .| |...|.:|.|.....|.|.|.|.|..||.:..:.|:.:..|
  Fly   282 EY-TDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETIIP 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 24/102 (24%)
Ig 130..200 CDD:143165 19/76 (25%)
I-set 226..310 CDD:254352 28/84 (33%)
IGc2 233..298 CDD:197706 24/65 (37%)
Ig 313..410 CDD:299845 25/97 (26%)
IG_like 325..410 CDD:214653 22/85 (26%)
LacNP_523713.2 IG_like 36..131 CDD:214653 25/103 (24%)
V-set 43..132 CDD:284989 24/94 (26%)
IG_like 143..222 CDD:214653 28/83 (34%)
IGc2 149..211 CDD:197706 25/66 (38%)
I-set 227..318 CDD:254352 23/93 (25%)
IGc2 236..310 CDD:197706 20/76 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80471922
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12231
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6406
65.970

Return to query results.
Submit another query.