DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Sdk2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_006247755.1 Gene:Sdk2 RGDID:1310397 Length:2175 Species:Rattus norvegicus

Alignment Length:455 Identity:99/456 (22%)
Similarity:155/456 (34%) Gaps:140/456 (31%)


  Fly     2 LPPSWH----LIGALLVLAATAGDSTNKIILPQILNGGGGGGGVGTAQGKHPSGSKTVATGVVPN 62
            :|||..    |...|::|:..|.|:....:  |.:|...|..  .|:|         ..|..|.|
  Rat   157 IPPSSRIAITLENTLVILSTVAPDAGRYYV--QAVNDKNGDN--KTSQ---------PITLAVEN 208

  Fly    63 FGGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFT-EYIENVTVPA 126
            .||.|       .|:|     .|::             :|..|.::|....|.| |.:.|    |
  Rat   209 VGGPA-------DPIA-----PTII-------------IPPKNTSVVAGTSEVTMECVAN----A 244

  Fly   127 GRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEE 191
            ...:||          .:.|.  :..|:|:  |.:...|.|:::|               |....
  Rat   245 RPLIKL----------HIVWK--KDGALLS--NGISDYNRRLTIT---------------NPMVS 280

  Fly   192 DRGRYMCQI----NTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGAN---------ISLRCRA 243
            |.|.|.|:.    ::|...|:..||:|:.||.          .|||...         :.:.|||
  Rat   281 DAGYYECEAMLRSSSVAPVTRGAYLSVLEPPQ----------FVREPERHITAEMEKVVDIPCRA 335

  Fly   244 SGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKV 308
            .|.|.|.|.|.: |.:.:.:.|.....:.....|:|:.:...|.|...|.|.|......:.....
  Rat   336 KGVPPPSITWYK-DAALVEVGKLTRFKQRSDGGLQISGLLPDDTGMVQCFAHNAAGEAQTSTYLA 399

  Fly   309 SVDFPPMLLIPHQLVGAP------EGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATV 367
            .....|      .:...|      :|.:|.:.|.|...|.....|.:||        :.....:|
  Rat   400 VTSIAP------NITRGPLDSTVIDGMSVVLACETSGAPRPAITWQKGE--------RILASGSV 450

  Fly   368 GLPAYKTHMKLTIINVSS--------GDDGIYKCVAKNPRG----ETDGII--RLYVSYPPTTAS 418
            .||      :.|::...|        .|.|.|.|:|.|.||    ..|.::  |..::.||...|
  Rat   451 QLP------RFTLLESGSLLISPTHISDAGTYTCLATNSRGVDEASADLVVWARTRITKPPQDQS 509

  Fly   419  418
              Rat   510  509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 21/100 (21%)
Ig 130..200 CDD:143165 14/70 (20%)
I-set 226..310 CDD:254352 20/93 (22%)
IGc2 233..298 CDD:197706 18/74 (24%)
Ig 313..410 CDD:299845 25/117 (21%)
IG_like 325..410 CDD:214653 24/105 (23%)
Sdk2XP_006247755.1 IG_like 43..112 CDD:214653
IGc2 43..101 CDD:197706
IG_like 123..206 CDD:214653 14/62 (23%)
Ig 135..191 CDD:299845 10/36 (28%)
IG_like 225..307 CDD:214653 25/115 (22%)
IGc2 236..289 CDD:197706 18/86 (21%)
I-set 311..400 CDD:254352 21/100 (21%)
Ig 329..397 CDD:143165 17/69 (25%)
I-set 405..495 CDD:254352 24/110 (22%)
Ig 419..495 CDD:299845 22/90 (24%)
Ig 505..589 CDD:299845 2/6 (33%)
IG_like 505..589 CDD:214653 2/6 (33%)
FN3 593..684 CDD:238020
FN3 696..789 CDD:238020
FN3 797..893 CDD:238020
FN3 898..986 CDD:238020
FN3 996..1090 CDD:238020
FN3 1102..1197 CDD:238020
FN3 1204..1293 CDD:238020
FN3 1304..1397 CDD:238020
FN3 1403..1487 CDD:238020
FN3 1506..1619 CDD:238020
FN3 1629..1722 CDD:238020
FN3 1727..1808 CDD:238020
FN3 1840..1919 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.