DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and LRIT3

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_940908.3 Gene:LRIT3 HGNCID:24783 Length:679 Species:Homo sapiens

Alignment Length:349 Identity:74/350 (21%)
Similarity:122/350 (35%) Gaps:102/350 (29%)


  Fly   155 LTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPN 219
            |.:||:.||..|..::.:.|:    ..||.:::             |.:|          .:|| 
Human   134 LDLHNNKITSVPNEALRYLKN----LAYLDLSS-------------NRLT----------TLPP- 170

  Fly   220 IDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGD-----TLEI 279
              |.|.|...:|...:.:     ...||..||...:|             |.|..|     .:|:
Human   171 --DFLESWTHLVSTPSGV-----LDLSPSRIILGLQD-------------NPWFCDCHISKMIEL 215

  Fly   280 TRISRLDMGAYL------CIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTE 338
            :::  :|....|      |.....:...:.:|.::.....|.::.....:.:..|.||.:.|...
Human   216 SKV--VDPAIVLLDPLMTCSEPERLTGILFQRAELEHCLKPSVMTSATKIMSALGSNVLLRCDAT 278

  Fly   339 AHPTSLNYWTRGEG-----PIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNP 398
            ..||....|||.:.     .:|.:|.:..|..::        |.||  .:||.|.|.|||.|||.
Human   279 GFPTPQITWTRSDSSPVNYTVIQESPEEGVRWSI--------MSLT--GISSKDAGDYKCKAKNL 333

  Fly   399 RGETDGIIRLYV------SYPPTTASSGIYSTDTH--WGENGINNNYAYGGPDSTRSIYAQDKNT 455
            .|.::.::.:.|      ..||.|:.    .|..|  |...          |.|.||......::
Human   334 AGMSEAVVTVTVLGITTTPIPPDTSE----RTGDHPEWDVQ----------PGSGRSTSVSSASS 384

  Fly   456 RYQSNLNEIGLSEQKSFLDKTQNP 479
            ...|:    ..|...||...|.:|
Human   385 YLWSS----SFSPTSSFSASTLSP 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 11/61 (18%)
Ig 130..200 CDD:143165 9/45 (20%)
I-set 226..310 CDD:254352 15/95 (16%)
IGc2 233..298 CDD:197706 12/76 (16%)
Ig 313..410 CDD:299845 27/102 (26%)
IG_like 325..410 CDD:214653 26/90 (29%)
LRIT3NP_940908.3 LRR 1 56..79
leucine-rich repeat 59..82 CDD:275378
LRR_8 61..117 CDD:290566
LRR 2 80..103
leucine-rich repeat 83..106 CDD:275378
LRR 3 104..128
LRR_8 105..165 CDD:290566 10/48 (21%)
LRR_4 105..146 CDD:289563 6/12 (50%)
leucine-rich repeat 107..130 CDD:275378
LRR 4 129..151 6/17 (35%)
LRR_4 131..170 CDD:289563 12/63 (19%)
leucine-rich repeat 131..154 CDD:275378 7/20 (35%)
LRR 5 152..175 9/53 (17%)
leucine-rich repeat 155..168 CDD:275378 4/36 (11%)
Ig 267..345 CDD:299845 26/88 (30%)
IG_like 267..345 CDD:214653 26/88 (30%)
FN3 486..550 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.