DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and DIP-iota

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster

Alignment Length:315 Identity:132/316 (42%)
Similarity:187/316 (59%) Gaps:25/316 (8%)


  Fly   104 SNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRI 168
            |.||  ..:|:|:..|.|.|||.||:..|.|.|.:|.|:||||:..:...||::.|||||:|.||
  Fly    24 SELN--NSDPKFSGPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRI 86

  Fly   169 SVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVRE 233
            |::|.:   ||.|.|.|.:|.|.|||.|||||||...|:|.|||:|||||:|.|..:|.||:...
  Fly    87 SISHTE---HRIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVVPPDIVDYQTSQDVVRST 148

  Fly   234 GANISLRCRASGSPRPIIKWKRDDNSRIAINK--NHIVNEWEGDTLEITRISRLDMGAYLCIASN 296
            |.|::|.|.|:|.|.|.|.|:|::.:.|.|:.  :..|...||..|.:.::.|..||||||||||
  Fly   149 GQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASN 213

  Fly   297 GVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTR-------GEGPI 354
            |||||||||:.:.|:|.|.:...:..:....|..:|:||.||:.|.|:|:|.|       |....
  Fly   214 GVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECITESQPASVNFWLRDSQLLQGGSYES 278

  Fly   355 IHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLY 409
            :...|.:::.           |::|:..::..|.|.|.|.|||..|:||.||.::
  Fly   279 VSVDHVFRIV-----------MRITLRPITKRDFGEYICRAKNAMGQTDRIITVH 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 51/96 (53%)
Ig 130..200 CDD:143165 35/70 (50%)
I-set 226..310 CDD:254352 40/86 (47%)
IGc2 233..298 CDD:197706 29/67 (43%)
Ig 313..410 CDD:299845 28/105 (27%)
IG_like 325..410 CDD:214653 27/93 (29%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 46/89 (52%)
Ig 39..122 CDD:299845 45/86 (52%)
Ig 132..213 CDD:299845 34/81 (42%)
IG_like 141..227 CDD:214653 40/86 (47%)
IG_like 239..322 CDD:214653 27/94 (29%)
IGc2 245..313 CDD:197706 22/79 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80592830
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I2478
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12231
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.