DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and DIP-theta

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster

Alignment Length:426 Identity:165/427 (39%)
Similarity:245/427 (57%) Gaps:48/427 (11%)


  Fly   106 LNIVVEE--PEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRI 168
            :|.:.|:  |:|.|.::|||||..|...|.|.|.||.:||:||:..:...|||:.|||||:|.|:
  Fly   121 VNAIPEKDLPKFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRM 185

  Fly   169 SVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVRE 233
            |:||.:   .|.|.|.|.:|.|.|:|.|||||||...|:|.|||:|||||:|.|..:|:|:::||
  Fly   186 SITHAE---KRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILDYPTSTDMVIRE 247

  Fly   234 GANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGV 298
            |:|::|:|.|:|||.|.|.|:|:....|.:........:.|..|.|.:::||:|||||||||||:
  Fly   248 GSNVTLKCAATGSPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGI 312

  Fly   299 PPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKV 363
            |||||||:.:.|.||||:.|.:|||||....|:|:||.:||:|.|:|||.:.: .||....::..
  Fly   313 PPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKND-TIIVPGERFVP 376

  Fly   364 EATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLY--------VSYPPTTASSG 420
            |....  .||..|:|||..|...|.|.|:|||||..|:|||.|:||        .:..||.:.:.
  Fly   377 ETFES--GYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTMTTMAPTVSINT 439

  Fly   421 I------YSTDTHWG--ENGINNNYAYGGPDSTRSIYAQDKNTRYQ-------------SNLNEI 464
            :      |:.:..:|  :|...|.|.:...:|       .:||:.|             |.||.:
  Fly   440 VPVVLVKYNKEQRYGSSQNSNTNPYNFNPGNS-------QQNTKLQRGKSNSKGSDQSPSGLNNV 497

  Fly   465 GLSEQKSFLDKTQNPLLANGNANEADAESNGARGHN 500
            .:....|..:...:    :.:::.:.:.|:..|.|:
  Fly   498 FVGATSSLWNSQDH----HSSSSSSSSASSRGRDHH 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 50/96 (52%)
Ig 130..200 CDD:143165 34/70 (49%)
I-set 226..310 CDD:254352 40/84 (48%)
IGc2 233..298 CDD:197706 30/65 (46%)
Ig 313..410 CDD:299845 45/105 (43%)
IG_like 325..410 CDD:214653 37/93 (40%)
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 50/96 (52%)
IG_like 137..230 CDD:214653 50/96 (52%)
IG_like 240..324 CDD:214653 40/84 (48%)
IGc2 247..310 CDD:197706 28/63 (44%)
Ig 327..419 CDD:299845 43/95 (45%)
IG_like 343..420 CDD:214653 35/80 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I2478
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12231
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.