DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and DIP-eta

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001188701.2 Gene:DIP-eta FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster

Alignment Length:435 Identity:169/436 (39%)
Similarity:243/436 (56%) Gaps:62/436 (14%)


  Fly   109 VVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHD 173
            |:.:|:|:..|.|:|.|.||:..|.|.|::||.|||||:..:...|||:.|||||:|.||.:.:.
  Fly    39 VIVDPKFSSPIVNMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANS 103

  Fly   174 KHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANIS 238
            :   |:||.:.|.::.|.|:|.|||||||...|:|.|||:|||||:|.|..:|:|::||||:|::
  Fly   104 E---HKTWTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVT 165

  Fly   239 LRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVS 303
            |:|.|:|||.|.|.|:|:....|.:.....|...||..|.|..:.|..||||||||||||||:||
  Fly   166 LKCAATGSPEPTITWRRESGVPIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVS 230

  Fly   304 KRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEAT-V 367
            |||.:.|.||||:.:.:||:||.||..||::|.:||:|.|:|||||..|.|:....||....| :
  Fly   231 KRITLVVHFPPMITVQNQLIGAVEGKGVTLDCESEAYPKSINYWTRERGEIVPPGGKYSANVTEI 295

  Fly   368 GLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYSTDTHWGENG 432
            |  .|:..|:|.|..::..:.|.|:|||||..|:|||.|:|| ..||                |.
  Fly   296 G--GYRNSMRLHINPLTQAEFGSYRCVAKNSLGDTDGTIKLY-RIPP----------------NA 341

  Fly   433 INNNYAYGGPDSTRSIYAQDKNTRYQSNLNEIGLSEQKSFLDKTQNPLLANGNANEADAESNGAR 497
            :|              |.::...|::      |....||  .::.:|..|..::.| |.|:.|.|
  Fly   342 VN--------------YVENFEARHK------GKKRTKS--SESHHPARAQEHSGE-DMENPGKR 383

  Fly   498 GHNPSMAIAWLFVV----------------IATLLLTIRSAVGSS 526
            ..:.|:....:..:                :..|||.:..||..|
  Fly   384 KADLSLGAESIDSIYGNSAAGSRRRQDLGGVLLLLLPVAVAVAMS 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 47/96 (49%)
Ig 130..200 CDD:143165 32/70 (46%)
I-set 226..310 CDD:254352 43/84 (51%)
IGc2 233..298 CDD:197706 31/65 (48%)
Ig 313..410 CDD:299845 45/98 (46%)
IG_like 325..410 CDD:214653 39/86 (45%)
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 45/93 (48%)
IG_like 51..137 CDD:214653 42/89 (47%)
IG_like 153..237 CDD:214653 43/84 (51%)
Ig 161..224 CDD:299845 29/63 (46%)
IG_like 252..335 CDD:214653 38/85 (45%)
Ig 258..333 CDD:143165 34/77 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80592889
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12231
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.