DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and DIP-eta

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_608946.3 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:435 Identity:169/435 - (38%)
Similarity:243/435 - (55%) Gaps:62/435 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 VVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHD 173
            |:.:|:|:..|.|:|.|.||:..|.|.|::||.|||||:..:...|||:.|||||:|.||.:.:.
  Fly    39 VIVDPKFSSPIVNMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANS 103

  Fly   174 KHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANIS 238
            :   |:||.:.|.::.|.|:|.|||||||...|:|.|||:|||||:|.|..:|:|::||||:|::
  Fly   104 E---HKTWTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVT 165

  Fly   239 LRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVS 303
            |:|.|:|||.|.|.|:|:....|.:.....|...||..|.|..:.|..||||||||||||||:||
  Fly   166 LKCAATGSPEPTITWRRESGVPIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVS 230

  Fly   304 KRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEAT-V 367
            |||.:.|.||||:.:.:||:||.||..||::|.:||:|.|:|||||..|.|:....||....| :
  Fly   231 KRITLVVHFPPMITVQNQLIGAVEGKGVTLDCESEAYPKSINYWTRERGEIVPPGGKYSANVTEI 295

  Fly   368 GLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYSTDTHWGENG 432
            |  .|:..|:|.|..::..:.|.|:|||||..|:|||.|:|| ..||                |.
  Fly   296 G--GYRNSMRLHINPLTQAEFGSYRCVAKNSLGDTDGTIKLY-RIPP----------------NA 341

  Fly   433 INNNYAYGGPDSTRSIYAQDKNTRYQSNLNEIGLSEQKSFLDKTQNPLLANGNANEADAESNGAR 497
            :|              |.::...|::      |....||  .::.:|..|..::.| |.|:.|.|
  Fly   342 VN--------------YVENFEARHK------GKKRTKS--SESHHPARAQEHSGE-DMENPGKR 383

  Fly   498 GHNPSMAIAWLFVV----------------IATLLLTIRSAVGSS 526
            ..:.|:....:..:                :..|||.:..||..|
  Fly   384 KADLSLGAESIDSIYGNSAAGSRRRQDLGGVLLLLLPVAVAVAMS 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 46/95 (48%)
Ig strand B 130..134 CDD:409405 1/3 (33%)
Ig strand C 143..147 CDD:409405 3/3 (100%)
Ig strand E 178..185 CDD:409405 3/6 (50%)
IgI_1_MuSK 218..310 CDD:409562 46/91 (51%)
Ig strand A 218..221 CDD:409562 1/2 (50%)
Ig strand A' 226..231 CDD:409562 2/4 (50%)
Ig strand B 237..244 CDD:409562 2/6 (33%)
Ig strand C 250..255 CDD:409562 2/4 (50%)
Ig strand C' 257..259 CDD:409562 0/1 (0%)
Ig strand D 267..270 CDD:409562 0/2 (0%)
Ig strand E 275..281 CDD:409562 2/5 (40%)
Ig strand F 288..295 CDD:409562 6/6 (100%)
Ig strand G 302..310 CDD:409562 5/7 (71%)
IG_like 325..410 CDD:214653 38/85 (45%)
Ig strand B 331..335 CDD:143207 2/3 (67%)
Ig strand C 344..348 CDD:143207 2/3 (67%)
Ig strand E 376..380 CDD:143207 2/3 (67%)
Ig strand F 390..395 CDD:143207 2/4 (50%)
Ig strand G 403..406 CDD:143207 2/2 (100%)
DIP-etaNP_608946.3 IG_like 51..137 CDD:214653 42/88 (48%)
Ig strand B 60..64 CDD:409353 1/3 (33%)
Ig strand C 73..77 CDD:409353 3/3 (100%)
Ig strand E 108..112 CDD:409353 1/3 (33%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
IgI_1_MuSK 145..237 CDD:409562 46/91 (51%)
Ig strand A 145..148 CDD:409562 1/2 (50%)
Ig strand A' 153..158 CDD:409562 2/4 (50%)
Ig strand B 164..171 CDD:409562 2/6 (33%)
Ig strand C 177..182 CDD:409562 2/4 (50%)
Ig strand C' 184..186 CDD:409562 0/1 (0%)
Ig strand D 194..197 CDD:409562 0/2 (0%)
Ig strand E 202..208 CDD:409562 2/5 (40%)
Ig strand F 215..222 CDD:409562 6/6 (100%)
Ig strand G 229..237 CDD:409562 5/7 (71%)
IG_like 252..335 CDD:214653 37/84 (44%)
Ig strand B 258..262 CDD:409353 2/3 (67%)
Ig strand C 271..282 CDD:409353 6/10 (60%)
Ig strand E 301..306 CDD:409353 2/4 (50%)
Ig strand F 316..321 CDD:409353 2/4 (50%)
Ig strand G 329..332 CDD:409353 2/2 (100%)

Return to query results.
Submit another query.