DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and itgb4

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_005166847.1 Gene:itgb4 / 335269 ZFINID:ZDB-GENE-030131-7209 Length:1931 Species:Danio rerio


Alignment Length:374 Identity:71/374 - (18%)
Similarity:127/374 - (33%) Gaps:113/374 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 AGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEYI-----ENVTVPAGRNVKLGCSVK 137
            ||....|.::.||.|:      ..|||:|...|.:....:::     :|...|.|..   |...:
Zfish  1450 AGEEYDSYLMYSNEVL------RSPTSSLRPSVTDLSDDQFVNGKWEQNFLFPGGGG---GSLSR 1505

  Fly   138 NLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYL--------HINNVHE---- 190
            |:.|....:.|               ..||.:||::.   ..|.|:        |..:|.:    
Zfish  1506 NISSSSTTYSH---------------STPRTNVTNNS---STTTYISGKGGSTTHRYDVRDGGLL 1552

  Fly   191 -ED-------RGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSP 247
             ||       ..|:..:.:.|......|.|:    ..:.|:|..|........:.||..||    
Zfish  1553 KEDVILRKRSENRHYTEGDGVRDSIVMGNLS----GGLLDNLGVSSFSQTTSTSYSLSSRA---- 1609

  Fly   248 RPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDF 312
                :.:.:|.:...:|.:.::.|           ||.         :.|||.|           
Zfish  1610 ----RTQSEDINDALLNLDSVLQE-----------SRF---------TPGVPAT----------- 1639

  Fly   313 PPMLLIPHQLVGAPEGFNVTIECFTEAHPTS--LNYWTRGEGPIIHDSHKYKVEATVGLPAYKTH 375
                  |.:||.:..|.......:.|.|..|  |.|....:  :|:.....::|  |..||..: 
Zfish  1640 ------PSRLVFSALGHTALKVSWQEPHCESDVLGYCVLYQ--LINGGDVKRIE--VNNPAQNS- 1693

  Fly   376 MKLTIINVSSGDDGIYKCVAKNPRG---ETDGIIRLYVSYPPTTASSGI 421
              :.:.::......|:|..|::..|   |.:|:|.:..:..|.:..|.:
Zfish  1694 --VLVQDLLPNQSYIFKVKAQSREGWGPEREGVITIESNVDPKSPLSPV 1740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 21/115 (18%)
Ig 130..200 CDD:143165 15/89 (17%)
I-set 226..310 CDD:254352 14/83 (17%)
IGc2 233..298 CDD:197706 9/64 (14%)
Ig 313..410 CDD:299845 21/101 (21%)
IG_like 325..410 CDD:214653 18/89 (20%)
itgb4XP_005166847.1 Integrin_beta 37..457 CDD:278776
EGF_2 <468..490 CDD:285248
EGF_2 545..573 CDD:285248
Integrin_B_tail 625..709 CDD:285239
Calx-beta 991..1064 CDD:295344
FN3 1242..1326 CDD:238020
FN3 1331..1420 CDD:238020
fn3 1640..1720 CDD:278470 18/86 (21%)
fn3 1751..1835 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.