DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and CG33543

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster

Alignment Length:537 Identity:105/538 (20%)
Similarity:166/538 (31%) Gaps:183/538 (34%)


  Fly     8 LIGALLVLAATAGDSTNKIILPQILNGGGGGGGVGTAQGKHPSGSKTVATGVVPNFGGAAGNGAG 72
            |...||:|.     |.|..||.|:.:...||.|.|.|....|                       
  Fly     7 LCSLLLLLL-----SQNAAILGQLDSTSSGGSGTGGAPPDRP----------------------- 43

  Fly    73 GGGPVAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVK 137
                                         ||..|::....|..|.::....:...:.|:.....|
  Fly    44 -----------------------------PTPPLSLQPSTPSITHFVNESFIIFCQTVQKDIDTK 79

  Fly   138 NLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHI------------NNVHE 190
                    |                 |:||.....:...|     :||            .::..
  Fly    80 --------W-----------------RDPRGQTRENTKGR-----VHIEKKTTGLLALVFEHIAL 114

  Fly   191 EDRGRYMCQIN-------TVTAKTQF-GYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSP 247
            ||||.:.|::|       .|..:.:| ....::|...|....:.....||||.:..:.|...|.|
  Fly   115 EDRGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMP 179

  Fly   248 RPIIKWKRDDNSRIAINK---NHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVS 309
            .|.:.|..:......:|.   |.:.|     .|.|..:|:.|.|.|.|.|.. :.||.|...:::
  Fly   180 APEVSWLYNGEYINTVNSTKHNRLSN-----GLYIRNVSQADAGEYTCRAMR-ITPTFSDSDQIT 238

  Fly   310 VDFPPMLLIPHQ----------LVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVE 364
            :    :|.|.|:          :..|..|..|.:.|.....|.....|......|:..:|:    
  Fly   239 I----LLRIQHKPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHR---- 295

  Fly   365 ATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPP--------------- 414
              :.:..|...::|.:.|.|...|  |||...||.|..:.:|:|.....|               
  Fly   296 --IFVADYGATLQLQMKNASQFGD--YKCKVANPLGMLERVIKLRPGPKPLGPRRFQLKKLYTNG 356

  Fly   415 ------TTASSGI------------YSTDTHWGENGINNNYA-------YGGPDSTRSIYAQDKN 454
                  |...|.:            |.:||.:..:..|.:||       :||....  |...:.|
  Fly   357 FELDIQTPRMSNVSDEMQIYGYRVAYMSDTEFKFSAGNWSYAKQRDFSFHGGKHFI--IPHLETN 419

  Fly   455 TRY---QSNLNEIGLSE 468
            |.|   .::.|..|||:
  Fly   420 TTYLMRAASRNLAGLSD 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 17/116 (15%)
Ig 130..200 CDD:143165 14/82 (17%)
I-set 226..310 CDD:254352 23/87 (26%)
IGc2 233..298 CDD:197706 18/68 (26%)
Ig 313..410 CDD:299845 24/107 (22%)
IG_like 325..410 CDD:214653 21/85 (25%)
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 17/64 (27%)
IG_like 256..336 CDD:214653 21/88 (24%)
IGc2 263..327 CDD:197706 17/72 (24%)
FN3 341..445 CDD:238020 19/99 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80570284
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12231
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.