DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and DIP-beta

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster

Alignment Length:406 Identity:160/407 (39%)
Similarity:223/407 (55%) Gaps:46/407 (11%)


  Fly    66 AAGNGAGGGGPVAGSGTGSTVVGSNGVI--------VAGGGANVPTSN--LNIVVEEPEFTEYIE 120
            |:|:|..|.|  .|:||||   |....|        :.|...::..||  .::...||:|...:|
  Fly    46 ASGSGLVGLG--TGTGTGS---GCGPAIRWQLLLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLE 105

  Fly   121 NVTVPAGRNVKLGCSVKNLGSY-----------KVAWMHFEQSAILTVHNHVITRNPRISVTHDK 174
            |||:..||:....|.|.|||.:           ||||:..:..|||.:|.||||.|.|:||   :
  Fly   106 NVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSV---Q 167

  Fly   175 HDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISL 239
            |:.:.||.|:|..|..||.|:||||:||...|.|...|.||:||:|.:..:|.|::|.||.:..|
  Fly   168 HNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKL 232

  Fly   240 RCRASGSPRPIIKWKRDDNSR-IAINKNH---IVNEWEGDTLEITRISRLDMGAYLCIASNGVPP 300
            .|||.|.|:|.|.|:|:|... ||.|.:|   .....||:.|.:::|:|.:||||:|||||||||
  Fly   233 VCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPP 297

  Fly   301 TVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEA 365
            |||||:|:.|.|.|::.:|:||||||...:||:.|..||.|.::|||.|..|.:|....:|.:..
  Fly   298 TVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYALTE 362

  Fly   366 TVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPP-----------TTASS 419
            ... ..|...|.|.|..:.|.|.|.|||::||..|:|:|.||||....|           ..:.:
  Fly   363 KEN-NMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYEMERPGKKILRDDDLNEVSKN 426

  Fly   420 GIYSTDTHWGENGINN 435
            .:...||. .|:|..|
  Fly   427 EVVQKDTR-SEDGSRN 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 47/107 (44%)
Ig 130..200 CDD:143165 34/81 (42%)
I-set 226..310 CDD:254352 44/88 (50%)
IGc2 233..298 CDD:197706 32/69 (46%)
Ig 313..410 CDD:299845 40/97 (41%)
IG_like 325..410 CDD:214653 34/85 (40%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 49/114 (43%)
ig 102..195 CDD:278476 41/96 (43%)
IG_like 219..307 CDD:214653 44/88 (50%)
Ig 221..307 CDD:299845 43/86 (50%)
Ig 311..404 CDD:299845 38/94 (40%)
IG_like 327..405 CDD:214653 31/79 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80734292
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I2478
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12231
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.