DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Sdk1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_808547.3 Gene:Sdk1 MGIID:2444413 Length:2193 Species:Mus musculus

Alignment Length:624 Identity:142/625 (23%)
Similarity:215/625 (34%) Gaps:201/625 (32%)


  Fly    12 LLVLAATAGDSTNKIILPQILNGGGGGGGVGTAQGKHPSGSKTVAT--GVVPNFGGAAGNGAGGG 74
            |::||.||.|:....:  |.:|...|..  .|:...|.|.::...|  .:.|....|.||.:   
Mouse   228 LVILATTASDAGAYYV--QAVNEKNGEN--KTSPFIHLSVARDTGTHEAMAPIIVVAPGNRS--- 285

  Fly    75 GPVAGSG--TGSTVVGS------------NGVIVAGG----GANVPTSN---------------- 105
             .||||.  |...:..:            |||.:..|    |..:..:|                
Mouse   286 -VVAGSSETTLECIANARPVEELSVHWKRNGVRLTSGLHSYGRRLTITNPTSADTGMYVCEATLR 349

  Fly   106 ------------LNIVVEEPEFT---------EYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHF 149
                        |:| :|.|.||         |..|.:.:|..   .:|..:..|..||.|   .
Mouse   350 GSTFEPARARAFLSI-IEPPYFTAEPESRILGEVEETMDIPCR---AMGVPLPTLQWYKDA---V 407

  Fly   150 EQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMC-------QINTVTAKT 207
            ..|.:         :|||..|.       .:..|||..:..||.|.:.|       ::.|.|   
Mouse   408 PLSKL---------QNPRYKVL-------PSGGLHIQKLSPEDSGIFQCFASNEGGEVQTHT--- 453

  Fly   208 QFGYLNVVVPPNIDDSLSSS--DVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVN 270
               ||:|.   ||..:.:..  |..|.:|....|||..||:|:|.|.|||.         |||:.
Mouse   454 ---YLDVT---NIAPAFTQRPVDTTVTDGMTAVLRCEVSGAPKPAITWKRG---------NHILA 503

  Fly   271 E----------WEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQ--LV 323
            .          .|...|.|..:...|.|.|.|.|:|         .:.||:...||.:.::  :|
Mouse   504 SGSVRIPRFMLLESGGLRIAPVFIQDAGNYTCYAAN---------TEASVNASAMLTVWNRTSIV 559

  Fly   324 GAPE------GFNVTIECFTEAHP-TSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTII 381
            ..||      |...|:.|.....| |||.|..:.:..:|..|...::       ..:....|.|.
Mouse   560 HPPEDRVVIKGTTATLCCGATHDPRTSLRYVWKKDNVVITASSSSRI-------VVEKDGSLVIS 617

  Fly   382 NVSSGDDGIYKCVAKNPRGETDGIIRLYV---SYPPTTASSGIYSTDTH-----W-----GENGI 433
            ...|||.|.|.|...:..|......||.|   .:||....:.:....:|     |     |.:.:
Mouse   618 QTWSGDIGDYTCEIISEGGSDSRTARLEVIELPHPPQNLLASLSPARSHSVTLSWVRPFDGNSPV 682

  Fly   434 --------NNNYAYG------GPDSTR-SIYAQDKNTRYQSN---LNEIG---LSEQKSFLDKTQ 477
                    .||..:.      ||:.|. ::........||..   :|::|   .|.:.|.|...:
Mouse   683 LYYIVQVSENNSPWKVHLSNVGPEMTGVTVSGLTPARTYQFRVCAVNQVGKGQYSTETSRLMLPE 747

  Fly   478 NP-------LLANGNANEA---------DAESNGA-RGH 499
            .|       ::|:|..|::         :.|.||. ||:
Mouse   748 EPPSAPPKNIVASGRTNQSIMVQWQPPPETEHNGVLRGY 786

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 24/103 (23%)
Ig 130..200 CDD:143165 17/77 (22%)
I-set 226..310 CDD:254352 27/96 (28%)
IGc2 233..298 CDD:197706 24/75 (32%)
Ig 313..410 CDD:299845 26/106 (25%)
IG_like 325..410 CDD:214653 23/92 (25%)
Sdk1NP_808547.3 Ig 476..552 CDD:299845 28/94 (30%)
I-set 557..646 CDD:254352 24/96 (25%)
Ig 562..646 CDD:299845 23/91 (25%)
FN3 650..741 CDD:238020 15/91 (16%)
fn3 753..839 CDD:278470 8/35 (23%)
FN3 854..949 CDD:238020
FN3 954..1036 CDD:238020
FN3 1052..1148 CDD:238020
FN3 1158..1253 CDD:238020
FN3 1261..1349 CDD:238020
FN3 1360..1453 CDD:238020
FN3 1459..1554 CDD:238020
FN3 1562..1676 CDD:238020
FN3 1686..1779 CDD:238020
FN3 1784..1865 CDD:238020
FN3 1885..1978 CDD:238020
PDZ-binding. {ECO:0000250|UniProtKB:Q6V4S5} 2187..2193
Ig_2 94..169 CDD:290606
IG_like 100..169 CDD:214653
IG_like 183..263 CDD:214653 12/39 (31%)
Ig 197..247 CDD:299845 7/21 (33%)
IG_like 281..357 CDD:214653 13/80 (16%)
IGc2 294..347 CDD:197706 7/53 (13%)
I-set 368..457 CDD:254352 27/117 (23%)
Ig 388..454 CDD:143165 20/94 (21%)
I-set 462..552 CDD:254352 30/108 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.