DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and CG6867

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_573262.2 Gene:CG6867 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster

Alignment Length:521 Identity:128/522 (25%)
Similarity:199/522 (38%) Gaps:152/522 (29%)


  Fly    32 LNGGGGGGGVGTAQGKHPSGSK--TVATGVV-----------PNFGGAAGN-GAGGGGPVAGSGT 82
            |.|..|..|||......|.|.|  ..|||..           |...|..|. ||.|...:.|...
  Fly   293 LPGAPGVDGVGHLGPAGPRGPKGDAGATGRAGLDGRDGVPGEPGLDGVPGRAGADGKNGLPGRDG 357

  Fly    83 GSTVVGSNG----VIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCS----VKNL 139
            ...:.|.:|    .|....||..|.....           ::.:..|.||..|.|.:    |..:
  Fly   358 KDGLHGKDGKDGLSITGPKGAQGPPGERG-----------LKGIAGPRGRPGKPGTNGIPGVPGI 411

  Fly   140 GSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVT 204
            .::|:.:                   |..|.::|                               
  Fly   412 NAWKLQY-------------------PNGSSSND------------------------------- 426

  Fly   205 AKTQFGYLNVVVPPNIDDSLSSSD----VIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINK 265
                     :::||:|.| :...|    |||.||.:::|.|.|:|:|.|.::|:|:|...|.:|.
  Fly   427 ---------LLIPPSITD-IQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNG 481

  Fly   266 NHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFN 330
            ..:.: ..|..|..|.|:|..|.||.|.|:||:.|..:....|.|.|.||:.:..|::.|....:
  Fly   482 VEMAS-ISGQFLRFTNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSS 545

  Fly   331 VTIECFTEAHPTSLNYWTRG-EGPIIHDSHKYKVEATVGLP-AYKTHMKLTIINVSSGDDGIYKC 393
            .|:||..||.|.::.||.|. :|.|:..|.||.:|:   .| .:||.|:|||.|:...|.|.|.|
  Fly   546 ATLECLVEAFPEAIRYWERAYDGKILDPSDKYGIES---YPEGFKTTMRLTISNLRKDDFGYYHC 607

  Fly   394 VAKN---------------PRGETDGI---IRLYVSYPPTT--------ASSGIYSTDTHWGENG 432
            ||:|               |..||..:   :::|...||.:        ....:|...    ::.
  Fly   608 VARNELNATMVNFEIAPQDPNSETPYVGNNMKVYGQRPPESECPVCDQCPDPSLYQCK----DSI 668

  Fly   433 INN-------NYAYGG-PDSTRS--IYAQDK-------NTRYQSNLNEIG--LSEQKSFLDKTQN 478
            :||       |.:|.| |...::  :||..|       |.::.|.|.:..  ...:|:|:....:
  Fly   669 LNNFEIQATGNLSYPGLPKRPKTCYLYAVGKPVFHKVVNEKFGSWLRDPSPDSDREKTFVTNEND 733

  Fly   479 P 479
            |
  Fly   734 P 734

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 10/100 (10%)
Ig 130..200 CDD:143165 7/74 (9%)
I-set 226..310 CDD:254352 31/88 (35%)
IGc2 233..298 CDD:197706 25/65 (38%)
Ig 313..410 CDD:299845 38/117 (32%)
IG_like 325..410 CDD:214653 35/105 (33%)
CG6867NP_573262.2 Collagen 306..364 CDD:189968 14/58 (24%)
IG_like 442..525 CDD:214653 30/84 (36%)
IGc2 449..511 CDD:197706 23/63 (37%)
IG_like 544..612 CDD:214653 30/71 (42%)
Ig 546..612 CDD:143165 30/69 (43%)
OLF 694..937 CDD:280371 9/42 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.