DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and cntn5

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_956098.1 Gene:cntn5 ZFINID:ZDB-GENE-030131-5640 Length:1056 Species:Danio rerio

Alignment Length:397 Identity:102/398 (26%)
Similarity:152/398 (38%) Gaps:80/398 (20%)


  Fly    75 GPVAGSGTGSTVV--GSNGVIVAGGGANVPTSNLNIVVEE-PEF---------TEYIENVTVPAG 127
            ||.:|...|:..|  |...|::....::.|....:.|..| |.|         ::...|:.:|..
Zfish   153 GPFSGKTRGAVSVREGQGVVLMCAPPSHSPEIIYSWVFNELPSFVAEDSRRFISQETGNLYIPKV 217

  Fly   128 RNVKLG---CSVKN---------------------LGSY--KVAWMHFEQSAI----LTVHNHVI 162
            :...:|   |.|||                     :|.|  |:. .||.|:.:    :||.....
Zfish   218 QPSDVGSYVCQVKNTVTNARVLSPPTPLTLKTDGVMGEYEPKIE-AHFPQTVLAAKGVTVRLECF 281

  Fly   163 T-RNPRISVTHDKHD---------RHRTWYLHINNVHEEDRGRYMCQINTVTAKTQF-GYLNVVV 216
            . .||..::|..|..         |.....|.|.|:..||.|.|.|:.......|.| |:|.|..
Zfish   282 ALGNPVPTITWRKMSGNIPKKARLRKSQAVLEIPNIQLEDSGSYECKAENTRGGTAFRGHLQVYT 346

  Fly   217 PPN----IDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTL 277
            .|.    |:|:...|      |..:...|||:|.|||..:|.|:.......::..:||   |: |
Zfish   347 LPQWISMINDTQLDS------GEQLRWECRATGKPRPTYRWLRNGEPLSTQSRVEMVN---GE-L 401

  Fly   278 EITRISRLDMGAYLCIASNGVPPTVSK-RIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHP 341
            .|.|:.:.|.|.|.|||.|......|. .:|:....|.....|.:|: |..|.:|::||...|.|
Zfish   402 TIHRLQQADSGMYQCIAENKYGAIYSSAELKILASAPMFNNNPVRLI-ATVGKDVSLECRPRASP 465

  Fly   342 TSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGII 406
            .....|.:.:       .:.:....:.|....|   |.|||.|..|:|.|.|.|:|..|..:...
Zfish   466 KPRISWRKND-------RRLQPSRRIMLLRNNT---LRIINSSRSDEGSYVCRAENQFGSAELTT 520

  Fly   407 RLYVSYP 413
            .|.|..|
Zfish   521 VLLVKEP 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 33/137 (24%)
Ig 130..200 CDD:143165 26/110 (24%)
I-set 226..310 CDD:254352 26/85 (31%)
IGc2 233..298 CDD:197706 23/65 (35%)
Ig 313..410 CDD:299845 26/97 (27%)
IG_like 325..410 CDD:214653 23/85 (27%)
cntn5NP_956098.1 Ig 56..149 CDD:299845
Ig 151..245 CDD:299845 19/92 (21%)
IG_like 163..236 CDD:214653 15/73 (21%)
Ig 258..345 CDD:299845 24/88 (27%)
IG_like 265..344 CDD:214653 20/79 (25%)
I-set 348..433 CDD:254352 29/95 (31%)
Ig 349..433 CDD:299845 28/94 (30%)
I-set 438..524 CDD:254352 26/97 (27%)
Ig 452..524 CDD:299845 22/82 (27%)
I-set 534..623 CDD:254352
Ig 543..627 CDD:299845
FN3 627..722 CDD:238020
FN3 732..824 CDD:238020
FN3 833..925 CDD:238020
FN3 933..1020 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.