DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and dpr18

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster

Alignment Length:303 Identity:73/304 (24%)
Similarity:112/304 (37%) Gaps:75/304 (25%)


  Fly   100 NVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMH--FEQSAILTVHNHVI 162
            |..||..|:|.....|||.:            |.|.|..|....|.|:.  .|:.::|||.|...
  Fly   224 NSATSGDNLVSAVHLFTEAV------------LNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTY 276

  Fly   163 TRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPP--NIDD-SL 224
            :.:|||.|   |......|.|.||....||.|.||||::|...:.....|.|:.||  .||: ..
  Fly   277 SGDPRIRV---KFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHER 338

  Fly   225 SSSDVIVREGANISLRCRASGS----PRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRL 285
            ...|...:.|:.:.|:|:.|.|    .|..| .|..|::..|:.|  ::||   .|.|:..|..:
  Fly   339 DVGDRYYKSGSTVDLQCQISRSFFQKERQTI-LKSTDSANDAVQK--LINE---TTSELNLIGNV 397

  Fly   286 DMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRG 350
            :.                              ..|:..|..          .|.:.|....|.:.
  Fly   398 NQ------------------------------TQHKFSGQD----------LEKYFTKFITWAKD 422

  Fly   351 EGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKC 393
            |.|:...:::....:.|.|.:     :::|.:....|.|.|.|
  Fly   423 EEPLQGMTNRRLSVSDVWLTS-----RISIGDAKLSDSGNYSC 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/98 (31%)
Ig 130..200 CDD:143165 27/72 (38%)
I-set 226..310 CDD:254352 17/88 (19%)
IGc2 233..298 CDD:197706 16/69 (23%)
Ig 313..410 CDD:299845 14/82 (17%)
IG_like 325..410 CDD:214653 12/70 (17%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 29/98 (30%)
Ig <258..326 CDD:299845 25/71 (35%)
IGc2 <417..461 CDD:197706 10/50 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.