DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Negr1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_006501639.1 Gene:Negr1 MGIID:2444846 Length:393 Species:Mus musculus

Alignment Length:302 Identity:92/303 (30%)
Similarity:142/303 (47%) Gaps:26/303 (9%)


  Fly   119 IENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISV-THDKHDRHRTWY 182
            ::|:.|..|....|.|.::: |:.|.||::  :|:|:.......:.:||:|: |.:|.|    :.
Mouse    39 VDNMLVRKGDTAVLRCYLED-GASKGAWLN--RSSIIFAGGDKWSVDPRVSISTLNKRD----YS 96

  Fly   183 LHINNVHEEDRGRYMCQINTV-TAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGS 246
            |.|.||...|.|.|.|.:.|. |.:|...:|.|.|||.|.|  .|:|:.:.||.|::|.|.|:|.
Mouse    97 LQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYD--ISNDMTINEGTNVTLTCLATGK 159

  Fly   247 PRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVD 311
            |.|:|.|:     .|:.:.....|   |..|:|..|:|...|.|.|.|.|.|.....|:::|.|:
Mouse   160 PEPVISWR-----HISPSAKPFEN---GQYLDIYGITRDQAGEYECSAENDVSFPDVKKVRVIVN 216

  Fly   312 FPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHM 376
            |.|.:.........| |.:..|.|.....|.....|.:||      ...:..:..:.:..:.|..
Mouse   217 FAPTIQEIKSGTVTP-GRSGLIRCEGAGVPPPAFEWYKGE------KRLFNGQQGIIIQNFSTRS 274

  Fly   377 KLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTAS 418
            .||:.||:....|.|.|||.|..|.|:..:.|.....|||:|
Mouse   275 ILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNQIIEPTTSS 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/98 (31%)
Ig 130..200 CDD:143165 22/71 (31%)
I-set 226..310 CDD:254352 28/84 (33%)
IGc2 233..298 CDD:197706 23/65 (35%)
Ig 313..410 CDD:299845 23/97 (24%)
IG_like 325..410 CDD:214653 22/85 (26%)
Negr1XP_006501639.1 Ig 38..129 CDD:299845 29/97 (30%)
IG_like 41..129 CDD:214653 29/95 (31%)
IG_like 139..215 CDD:214653 28/84 (33%)
IGc2 146..204 CDD:197706 24/66 (36%)
IG_like 225..306 CDD:214653 21/88 (24%)
Ig 237..303 CDD:143165 19/72 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80620603
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 1 1.000 T130864
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6406
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.