DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and DIP-kappa

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster

Alignment Length:416 Identity:181/417 (43%)
Similarity:250/417 (60%) Gaps:34/417 (8%)


  Fly   113 PEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDR 177
            |.|.|.|.||||..||:..:.|.|:||..|||||:..:...||::|::||::|.|||:|::.   
  Fly    74 PRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYND--- 135

  Fly   178 HRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCR 242
            ||:|||||..|.|.|||.||||:||...:::.|||.|||||.|.:.|:|:|::||||.||||.|:
  Fly   136 HRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCK 200

  Fly   243 ASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIK 307
            |.|.|.|.:.|:|:|...:.|...| ||..:|:.|.||::|||.|.||||:|||||||::|||:.
  Fly   201 ARGYPEPYVMWRREDGEEMLIGGEH-VNVVDGELLHITKVSRLHMAAYLCVASNGVPPSISKRVH 264

  Fly   308 VSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGP-IIHDS----HKYKVEATV 367
            :.|.|||||.||:||.||..|.:|.:||.|||:|.|:||||...|. ||.|:    .||:..:||
  Fly   265 LRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDKYETTSTV 329

  Fly   368 GLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYSTDTHWGENG 432
            .  .|..:|||.|..|...|.|.|:|||||..|||||.|:|.....||||.....|.        
  Fly   330 S--GYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDEMPTPTTAIISEMSL-------- 384

  Fly   433 INNNYAYGGPDSTRSIYAQDKNTRYQSN-LNEIGLSEQKSFLDKTQ-NPLLANGNANEADAESNG 495
            :|.:|     |..|    :.:|....:| |.:.|:.|.:   |..| |....||:.|:....:..
  Fly   385 LNRSY-----DGKR----RHRNKFDSANALPDYGVEEWR---DGAQGNNAGNNGDNNQTPVRNPP 437

  Fly   496 ARGHNPSMAIAWLFVVIATLLLTIRS 521
            ...||.:.::| ...::|.::|.|::
  Fly   438 GAFHNSAGSLA-QHNLLAKIMLGIKT 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 48/96 (50%)
Ig 130..200 CDD:143165 35/70 (50%)
I-set 226..310 CDD:254352 44/84 (52%)
IGc2 233..298 CDD:197706 34/65 (52%)
Ig 313..410 CDD:299845 52/102 (51%)
IG_like 325..410 CDD:214653 43/90 (48%)
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 47/95 (49%)
IG_like 82..174 CDD:214653 48/95 (51%)
IG_like 184..267 CDD:214653 44/84 (52%)
IGc2 191..255 CDD:197706 34/65 (52%)
IG_like 282..368 CDD:214653 42/88 (48%)
Ig 288..367 CDD:143165 40/81 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80592859
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12231
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.