DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Nrg

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001245581.1 Gene:Nrg FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster

Alignment Length:484 Identity:123/485 (25%)
Similarity:183/485 (38%) Gaps:134/485 (28%)


  Fly    89 SNGVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMH----F 149
            ||||    |.|...:..|| |...|.||:..|..|......|...|....:...|::|:|    .
  Fly   320 SNGV----GNAQSFSIILN-VNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPI 379

  Fly   150 EQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFG---- 210
            |||          |.|||.:||.:.        :.|.|:.:.|.|.|.|     .|....|    
  Fly   380 EQS----------TPNPRRTVTDNT--------IRIINLVKGDTGNYGC-----NATNSLGYVYK 421

  Fly   211 --YLNV-VVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDN----SRIAINKNHI 268
              |||| ..||.|.::.::...:  :|.|::::||.:|||:|::||.|..|    .|..:..|  
  Fly   422 DVYLNVQAEPPTISEAPAAVSTV--DGRNVTIKCRVNGSPKPLVKWLRASNWLTGGRYNVQAN-- 482

  Fly   269 VNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNV-- 331
                 || |||..::..|.|.|.|.|.|       |..::..|...::....::...|:.:.|  
  Fly   483 -----GD-LEIQDVTFSDAGKYTCYAQN-------KFGEIQADGSLVVKEHTRITQEPQNYEVAA 534

  Fly   332 ----TIECFTEAHPTSL----NYWTRGEGPIIHDSHKYKVEATVGLPAY-KTH-MKLTIINVSSG 386
                |..| .|||..:|    ::|..|:      |..::.:     |.: ||: ..|||......
  Fly   535 GQSATFRC-NEAHDDTLEIEIDWWKDGQ------SIDFEAQ-----PRFVKTNDNSLTIAKTMEL 587

  Fly   387 DDGIYKCVAKNPRGETDGIIRLYVSYPPTTAS-SGIY----STDTHWGENGINN----------N 436
            |.|.|.|||:....|......|.|...|.... :||.    ..:.||.:.|.|.          |
  Fly   588 DSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGITCQADKAEIHWEQQGDNRSPILHYTIQFN 652

  Fly   437 YAYGGPDSTRSIYAQDKNT------------RYQSNL---NEIGLSEQKSFLDK--TQ------N 478
            .:: .|.|..:.|.:..||            .|...:   |:||.|...:..|.  ||      |
  Fly   653 TSF-TPASWDAAYEKVPNTDSSFVVQMSPWANYTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKN 716

  Fly   479 PLLANGNANEADAESNGARGHNPSMAIAW 507
            |....|...|.:           ::.|:|
  Fly   717 PDNVVGQGTEPN-----------NLVISW 734

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 28/107 (26%)
Ig 130..200 CDD:143165 20/74 (27%)
I-set 226..310 CDD:254352 26/88 (30%)
IGc2 233..298 CDD:197706 25/69 (36%)
Ig 313..410 CDD:299845 25/109 (23%)
IG_like 325..410 CDD:214653 25/97 (26%)
NrgNP_001245581.1 Ig 55..128 CDD:299845
IG_like 57..127 CDD:214653
Ig 135..214 CDD:299845
IG_like 141..216 CDD:214653
ig 251..332 CDD:278476 6/16 (38%)
I-set 339..427 CDD:254352 30/111 (27%)
Ig 354..427 CDD:299845 25/96 (26%)
I-set 432..517 CDD:254352 29/102 (28%)
Ig 446..517 CDD:299845 27/86 (31%)
I-set 522..611 CDD:254352 25/101 (25%)
ig 525..609 CDD:278476 24/96 (25%)
FN3 613..707 CDD:238020 19/95 (20%)
FN3 716..807 CDD:238020 6/31 (19%)
fn3 817..905 CDD:278470
FN3 917..1004 CDD:238020
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:290593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12231
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.