DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and dpr14

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster

Alignment Length:220 Identity:57/221 (26%)
Similarity:91/221 (41%) Gaps:31/221 (14%)


  Fly   111 EEPEFTEYIE--------------NVTVPAGRNVKLGCSVKNLGSYKVAWM--HFEQSAILTVHN 159
            ||.|.||...              |::.....:|.|.|.|.:|....|:||  ..:...::|...
  Fly    59 EELEVTETTTHEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQ 123

  Fly   160 HVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVP--PNIDD 222
            |..:.:.|.|:   :.:....|.|.|...:|.|.|.|.||:::........||.::||  ..:|:
  Fly   124 HTYSGDSRYSL---EFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDE 185

  Fly   223 SLSSS-DVIVREGANISLRCRASGSPRP--IIKWKRD------DNSRIAIN-KNHIVNEWEGDTL 277
            ..|:: :...:.|:.|.|:|..|..|.|  .|.|:..      |.||..|: |..::.......|
  Fly   186 RGSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRL 250

  Fly   278 EITRISRLDMGAYLCIASNGVPPTV 302
            .|...:|.|.|.|.|:..|.:..||
  Fly   251 YIANANRQDTGNYTCMLGNEITETV 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 24/112 (21%)
Ig 130..200 CDD:143165 21/72 (29%)
I-set 226..310 CDD:254352 24/88 (27%)
IGc2 233..298 CDD:197706 22/74 (30%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 22/83 (27%)
Ig 84..169 CDD:299845 21/88 (24%)
IG_like 191..279 CDD:214653 24/86 (28%)
Ig 201..274 CDD:143165 21/73 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.