DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Prtg

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001032740.1 Gene:Prtg RGDID:1307157 Length:1193 Species:Rattus norvegicus

Alignment Length:442 Identity:102/443 (23%)
Similarity:164/443 (37%) Gaps:114/443 (26%)


  Fly    99 ANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVIT 163
            |::..|.::.....|..||      ||.|...:..|.:.:.....:.| .|.::|:....:..:|
  Rat   121 AHLTLSTISAFEVHPVSTE------VPEGGVARFSCKISSTPPAVITW-EFNRTALPMTMDSRVT 178

  Fly   164 RNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAK---------------TQFGYLN 213
            ..|             :..|.|.:...||.|:|.|...|...|               |:..|:.
  Rat   179 ALP-------------SGVLQIYDAGPEDAGKYRCVAATHAHKRKSMEASLTIVPANETRSFYMP 230

  Fly   214 VVV--PPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDD-------NSRIAINKNHIV 269
            .::  |.|:..||..:         :.|.|.|:|.|:|||.|.|.|       |:|:..|.|.|:
  Rat   231 TIIASPQNVTASLHQT---------VVLECMATGYPKPIISWSRLDHKSIDVFNTRVLGNGNLII 286

  Fly   270 NEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRI---KVSVDFPPMLLIPHQLVGAPEGFNV 331
            ::          :.....|.|:|.|:  .|.|.:..:   .::|..||..:...:.:..|.....
  Rat   287 SD----------VKLQHAGVYVCRAT--TPGTRNFTVAMATLTVLAPPSFVEWPESLTRPRAGTA 339

  Fly   332 TIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAK 396
            ...|..|..|:....|.: .|..||.:.:.|:        |.:  ||.|..:...||.||:|:|:
  Rat   340 RFVCQAEGIPSPKMSWLK-NGRRIHSNGRIKM--------YNS--KLVINQIIPEDDAIYQCMAE 393

  Fly   397 NPRGETDGIIRL------------YVSYPPTTASSGI--------YSTD------THWGE-NGIN 434
            |.:|......||            |..:..|.:||.|        |::|      .|:.: .|:|
  Rat   394 NSQGSVLSRARLTVVMSEDRPSAPYNVHAETMSSSAILLAWERPLYNSDKVIAYSVHYMKAEGLN 458

  Fly   435 NN--YAYGGPDSTRSI---YAQDKN-TRYQSNLNEIGLSEQKSFLDKTQNPL 480
            |.  ....|.|:|..|   ...|.| |.|......:|.|:....:  |||.|
  Rat   459 NEEYQVVLGNDTTHYIIDDLEPDSNYTFYIVAYMPMGASQMSDHV--TQNTL 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/111 (18%)
Ig 130..200 CDD:143165 13/70 (19%)
I-set 226..310 CDD:254352 22/94 (23%)
IGc2 233..298 CDD:197706 20/72 (28%)
Ig 313..410 CDD:299845 26/109 (24%)
IG_like 325..410 CDD:214653 24/97 (25%)
PrtgNP_001032740.1 Ig 34..124 CDD:299845 1/3 (33%)
I-set 35..125 CDD:254352 1/4 (25%)
I-set 131..218 CDD:254352 21/107 (20%)
Ig 146..215 CDD:143165 15/83 (18%)
IG_like 236..318 CDD:214653 26/103 (25%)
IGc2 245..304 CDD:197706 20/80 (25%)
I-set 322..407 CDD:254352 24/96 (25%)
Ig 340..407 CDD:299845 22/78 (28%)
FN3 414..507 CDD:238020 24/95 (25%)
FN3 512..605 CDD:238020
FN3 614..694 CDD:238020
FN3 721..809 CDD:238020
FN3 816..906 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.