DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Dscaml1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001101611.1 Gene:Dscaml1 RGDID:1304887 Length:2111 Species:Rattus norvegicus

Alignment Length:621 Identity:136/622 (22%)
Similarity:198/622 (32%) Gaps:217/622 (35%)


  Fly    46 GKHPSGSKTVATGVVPNFGGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVV 110
            |.|.:...|::.|...:.....|.....||....:...|  |||            ......|.|
  Rat   510 GSHRTNQYTMSDGTTISHMNVTGPQIRDGGVYRCTARNS--VGS------------AEYQARINV 560

  Fly   111 EEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNH--VITRN-------- 165
            ..|.....:.|:|..|||:..:.|.|.....|.:.|.   :.|:|...||  |:..|        
  Rat   561 RGPPSIRAMRNITAVAGRDTLINCRVIGYPYYSIKWY---KDALLLPDNHRQVVFENGTLKLTDV 622

  Fly   166 ----------------PRISVTHDKHDRHR----------------------------------T 180
                            |::|::...|...:                                  |
  Rat   623 QKGMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLIQPFEFPPASIGQLLYIPCVVSSGDMPIRIT 687

  Fly   181 W----------------------YLHINNVHEEDRGRYMCQIN----TVTAKTQFGYLNVVVPPN 219
            |                      .|.|::|..:..|.|.|..:    ||:.:.|   |.|.|||.
  Rat   688 WRKDGQVIISGSGVTIESKEFMSSLQISSVSLKHNGNYTCIASNAAATVSRERQ---LIVRVPPR 749

  Fly   220 IDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNS-------------RIAINKNHIVNE 271
            .....::.|.|.  |....|.|...|.|.|.:.||....|             ||.|..|     
  Rat   750 FVVQPNNQDGIY--GKAGVLNCSVDGYPPPKVMWKHAKGSGNPQQYHPVPLTGRIQILPN----- 807

  Fly   272 WEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECF 336
               .:|.|..:...|:|.|||.|||||...:||.:.::|..|.|      :...|   |.||.  
  Rat   808 ---SSLLIRHVLEEDIGYYLCQASNGVGTDISKAMFLTVKIPAM------ITSHP---NTTIA-- 858

  Fly   337 TEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGI----------- 390
            .:.|...||...|||.|||   .:::...||..|  ...|:..|....:||:.:           
  Rat   859 IKGHAKELNCTARGERPII---IRWEKGDTVIDP--DRVMRYAIATKDNGDEVVSTLKLKPADRG 918

  Fly   391 ----YKCVAKNPRGETDGIIRLYVSYPPTTASSGI-----YSTDTHWGE----NGI--------- 433
                :.|.|.|..||..|:|:|.|..||......|     .|.:..|.:    |.|         
  Rat   919 DSVFFSCHAINSYGEDRGLIQLTVQEPPDPPELEIREVKARSMNLRWTQRFDGNSIITGFDIEYK 983

  Fly   434 NNNYAYGGPDSTRSIYAQDKNTRYQSNL----------------NEIGLSEQKSFL--------- 473
            |.:.::....|||:|    ..|..|:|:                |:||.||....|         
  Rat   984 NKSDSWDFKQSTRNI----SPTINQANIVDLHPASVYSIRMYSFNKIGRSEPSKELTISTEEAAP 1044

  Fly   474 -----DKTQNPLLANG-----NANEADAESNGARGH 499
                 |.|..|:.:..     .|.:.:.::...||:
  Rat  1045 DGPPMDVTLQPVTSQSIQVTWKAPKKELQNGIIRGY 1080

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 31/182 (17%)
Ig 130..200 CDD:143165 21/152 (14%)
I-set 226..310 CDD:254352 29/97 (30%)
IGc2 233..298 CDD:197706 24/78 (31%)
Ig 313..410 CDD:299845 30/112 (27%)
IG_like 325..410 CDD:214653 28/100 (28%)
Dscaml1NP_001101611.1 IG 101..173 CDD:214652
IGc2 101..168 CDD:197706
Ig 183..276 CDD:299845
IG_like 195..276 CDD:214653
I-set 291..369 CDD:254352
IGc2 298..359 CDD:197706
IGc2 386..447 CDD:197706
I-set 466..560 CDD:254352 12/64 (19%)
Ig 466..556 CDD:299845 11/60 (18%)
IGc2 577..635 CDD:197706 12/61 (20%)
IG_like 665..744 CDD:214653 12/82 (15%)
Ig 673..739 CDD:143165 10/66 (15%)
I-set 748..843 CDD:254352 30/105 (29%)
Ig7_DSCAM 765..843 CDD:143211 26/86 (30%)
I-set 849..942 CDD:254352 28/103 (27%)
Ig 861..949 CDD:299845 27/93 (29%)
FN3 945..1039 CDD:238020 21/98 (21%)
FN3 1046..1143 CDD:238020 6/36 (17%)
fn3 1151..1237 CDD:278470
FN3 1249..1340 CDD:238020
IGc2 1364..1428 CDD:197706
FN3 1442..1532 CDD:238020
FN3 1546..1618 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.