DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Kirrel3

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_017451106.1 Gene:Kirrel3 RGDID:1311382 Length:784 Species:Rattus norvegicus

Alignment Length:461 Identity:94/462 (20%)
Similarity:152/462 (33%) Gaps:153/462 (33%)


  Fly   115 FTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWM-------------HFEQSAILTVHNHVITRNP 166
            |::..::..|.:|:.|.|.|::.....: |.|:             .:.|  .|.|.||      
  Rat    56 FSQQPQDQVVVSGQPVTLLCAIPEYDGF-VLWIKDGLALGVGRDLSSYPQ--YLVVGNH------ 111

  Fly   167 RISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIV 231
             :|..|         :|.|.....:|...|.||......:::...|.|:|||:....|....:.:
  Rat   112 -LSGEH---------HLKILRAELQDDAVYECQAIQAAIRSRPARLTVLVPPDDPIILGGPVISL 166

  Fly   232 REGANISLRCRA-SGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITR---------ISRLD 286
            |.|..::|.|.| :..|...|.|.|         |..::|   |.|...|.         :|.|.
  Rat   167 RAGDPLNLTCHADNAKPAASIIWLR---------KGEVIN---GATYSKTLLRDGKRESIVSTLF 219

  Fly   287 MG--------AYLCIASN-GVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPT 342
            :.        :.:|.|:| .:|......:.:.:..||::.:..:.....|...||..|..:|:|.
  Rat   220 ISPGDVENGQSIVCRATNKAIPGGKETSVTIDIQHPPLVNLSVEPQPVLEDNIVTFHCSAKANPA 284

  Fly   343 SLNY-WTRGEGPIIHDS----------HKYKVE-------------------------------- 364
            ...| |.: .|.||.::          :.|..|                                
  Rat   285 VTQYRWAK-RGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTSEPQ 348

  Fly   365 --------------ATVGLPA-------------YKTHMKLTIINVSSGDDGIYKCVAKNPR--- 399
                          |.:|.|:             ......||:.:|...|.|.|.|.|..||   
  Rat   349 SLLVDLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGA 413

  Fly   400 GETDGIIRLYVSYPPTTASSGIYSTDTH---WGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNL 461
            ||.:  :.|.|:.||.     |.||.|.   .||.|....:....|...|..::      ::.|:
  Rat   414 GERE--VTLTVNGPPI-----ISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWS------WKENV 465

  Fly   462 NEIGLS 467
            .|.|.|
  Rat   466 LESGTS 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/109 (20%)
Ig 130..200 CDD:143165 18/83 (22%)
I-set 226..310 CDD:254352 20/103 (19%)
IGc2 233..298 CDD:197706 18/84 (21%)
Ig 313..410 CDD:299845 31/170 (18%)
IG_like 325..410 CDD:214653 29/158 (18%)
Kirrel3XP_017451106.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.