DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Igsf9b

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_006226409.1 Gene:Igsf9b RGDID:1564717 Length:1441 Species:Rattus norvegicus

Alignment Length:403 Identity:100/404 (25%)
Similarity:152/404 (38%) Gaps:103/404 (25%)


  Fly    84 STVVGSNGVI--VAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKN--LGS--- 141
            ::|:.:.|::  ||.|           :.|||||      ||..||..|.|.|.|.:  .|.   
  Rat    10 ASVISTRGLVAQVAHG-----------LREEPEF------VTARAGEGVVLRCDVIHPVTGQPPP 57

  Fly   142 YKVAWMHFEQSAILTVH-----NHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQIN 201
            |.|.|..|.....:.:.     .||   :|..:.....||:..   |.:..|..||:|.|.|:: 
  Rat    58 YVVEWFKFGVPIPIFIKFGYYPPHV---DPEYAGRASLHDKAS---LRLEQVRSEDQGWYECKV- 115

  Fly   202 TVTAKTQFG--------YLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDN 258
             :....|:.        :|.:..||...:: ....:..:||.:|::.|.|.|:|:||:.|.::..
  Rat   116 -LMLDQQYDTFHNGSWVHLTINAPPTFTET-PPQYIEAKEGGSITMTCTAFGNPKPIVTWLKEGT 178

  Fly   259 SRIAINKNHIVNEWEGDTLEITRISRLDMGAYLC----IASNGVPPTVSKRIKVSVDFPPMLLIP 319
            ...|..|..:    ...:|.:|.:||.|.|||.|    |....|..|     .:.|..||.::.|
  Rat   179 LLSASGKYQV----SDGSLTVTSVSREDRGAYTCRAYSIQGEAVHTT-----HLLVQGPPFIVSP 234

  Fly   320 HQLVGAPEGFNVTIE------CFTEAHPTSLN---YWTRGEGPIIHDSHKYKVEATVGLPAYKTH 375
                  ||...|.|.      |..||:|.:|.   || :.|.....:..|.:|...:       .
  Rat   235 ------PENITVNISQDALLTCRAEAYPGNLTYTWYW-QDENVYFQNDLKLRVRILI-------D 285

  Fly   376 MKLTIINVSSGDDGIYKCVAKNPRGET-DGIIRLYVSYPPTTASS--------GIY--------- 422
            ..|.|..|...|.|.|.||..|..|.: .....|.|.||....:.        ||:         
  Rat   286 GTLIIFRVKPEDAGKYTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDA 350

  Fly   423 ---STDTHWGENG 432
               :|...|.::|
  Rat   351 EPPATVVKWNKDG 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 27/114 (24%)
Ig 130..200 CDD:143165 21/80 (26%)
I-set 226..310 CDD:254352 24/88 (27%)
IGc2 233..298 CDD:197706 22/69 (32%)
Ig 313..410 CDD:299845 28/107 (26%)
IG_like 325..410 CDD:214653 25/95 (26%)
Igsf9bXP_006226409.1 IG_like 30..115 CDD:214653 28/97 (29%)
Ig 41..115 CDD:143165 21/80 (26%)
I-set 139..225 CDD:254352 25/96 (26%)
IGc2 153..210 CDD:197706 21/61 (34%)
I-set 229..321 CDD:254352 27/106 (25%)
Ig 235..321 CDD:299845 25/94 (27%)
IG_like 331..414 CDD:214653 5/34 (15%)
Ig <353..414 CDD:299845 3/12 (25%)
IG_like 426..505 CDD:214653
Ig 442..505 CDD:299845
FN3 510..605 CDD:238020
FN3 621..703 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.