DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and DIP-alpha

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001259218.1 Gene:DIP-alpha FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster

Alignment Length:398 Identity:160/399 (40%)
Similarity:226/399 (57%) Gaps:38/399 (10%)


  Fly   112 EPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTH-DKH 175
            :|||.|.|.||:|..||:....|.|::||.|:|.|:..:..||..:|.:|||.|||::|:| |::
  Fly    41 QPEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQN 105

  Fly   176 DRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLR 240
                ||.|||..|.|||||.||||:||...|:|.|:|:||:||:.....:||||||.||:::.|.
  Fly   106 ----TWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLT 166

  Fly   241 CRASGSPRPIIKWKRDDNSRIAINKN----HIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPT 301
            |||.|.|.||:.|:|:|.:.|.:..|    .:...:.|:.|::::|||.:||:|||||||||||:
  Fly   167 CRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPS 231

  Fly   302 VSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEAT 366
            |||||.:|:.|.|::.:|:||||||.|.:|.|||..||.|.|:|||.:..|.:|..|.||.|:.:
  Fly   232 VSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQES 296

  Fly   367 VGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYSTDTHWGEN 431
             ....|:|.|.:.:......|.|.|:|:|||..||.|..||||....|..            .:|
  Fly   297 -SQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNR------------NKN 348

  Fly   432 GINNNYAYGGPDSTRSIYAQDKNTRYQSNLNEIGLSEQKSFLDKTQNP---LLANGNANEADAES 493
            .:|.....||...:....|.|             :.:||..:..|..|   .|..|:..:.:||.
  Fly   349 PLNGGGKGGGAGGSLDADAND-------------ILKQKQQVKVTYQPEDEELQYGSVEDFEAEG 400

  Fly   494 NGARGHNP 501
            ....|..|
  Fly   401 GEGGGLTP 408

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 47/97 (48%)
Ig 130..200 CDD:143165 34/71 (48%)
I-set 226..310 CDD:254352 45/88 (51%)
IGc2 233..298 CDD:197706 30/69 (43%)
Ig 313..410 CDD:299845 43/97 (44%)
IG_like 325..410 CDD:214653 37/85 (44%)
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 41/84 (49%)
Ig 51..131 CDD:299845 40/84 (48%)
I-set 144..240 CDD:254352 46/96 (48%)
IGc2 159..228 CDD:197706 30/69 (43%)
Ig 244..337 CDD:299845 41/94 (44%)
I-set 244..337 CDD:254352 41/94 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I2478
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12231
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.