DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and kirre

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001245505.1 Gene:kirre FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster

Alignment Length:440 Identity:98/441 (22%)
Similarity:154/441 (35%) Gaps:94/441 (21%)


  Fly     1 MLPPSWHLIGALLV--LAATAGDSTNKIILPQILNGGGGGGGVGTAQGKHPSGSKTVATGVVPNF 63
            :||....||..||:  :|..|....||                 ::|..|...|.:         
  Fly    11 VLPLILVLILTLLLQPIAVHAKSKKNK-----------------SSQSSHHGDSSS--------- 49

  Fly    64 GGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGR 128
            ..::.:.:.|....|.|..........|   ..||.:        ...||      ::.|...|.
  Fly    50 SSSSSSSSSGSSSAAASSANDESKPKGG---DNGGQH--------FAMEP------QDQTAVVGS 97

  Fly   129 NVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDR 193
            .|.|.|.|..    ||..:.:.:.......:..::...|.|:...  |....:.|.|..:..:|.
  Fly    98 RVTLPCRVME----KVGALQWTKDDFGLGQHRNLSGFERYSMVGS--DEEGDFSLDIYPLMLDDD 156

  Fly   194 GRYMCQI-----NTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRC-RASGSPRPIIK 252
            .:|.||:     .....:::|..|.|:|||..........::..|...|.|.| ...|.|...|.
  Fly   157 AKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQGDYLVTTEDREIELECVSQGGKPAAEIT 221

  Fly   253 WKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMG--------AYLCIASNGVPPTV-SKRIKV 308
            | .|....:.......|.|...|:..||..|.|.:.        .:.|.|.|....|. |.::.:
  Fly   222 W-IDGLGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLL 285

  Fly   309 SVDFPPMLLIPHQLVGA-------PEGFNVTIECFTEAHPTSLNY-WTRGEGPIIHDSHKYKVEA 365
            .|.:.|.:::  .:||.       |||..|.:.|..:|:|..|:| |      .|:|      |.
  Fly   286 EVKYAPKVIV--SVVGGALAGGKIPEGAEVILSCQADANPHELSYRW------FIND------EL 336

  Fly   366 TVGLPAYKTHMKLTIINVS-SGDDGIYKCVAKNPRGETDGIIRLYVSYPP 414
            ..|  .:.|  |:.|.||| ...|.|.||...|..|:::...:|.:|:.|
  Fly   337 MTG--DFTT--KMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGP 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/101 (20%)
Ig 130..200 CDD:143165 15/70 (21%)
I-set 226..310 CDD:254352 21/94 (22%)
IGc2 233..298 CDD:197706 19/74 (26%)
Ig 313..410 CDD:299845 30/106 (28%)
IG_like 325..410 CDD:214653 27/94 (29%)
kirreNP_001245505.1 Ig 87..183 CDD:299845 22/108 (20%)
IG_like 88..182 CDD:214653 20/106 (19%)
C2-set_2 189..279 CDD:285423 20/91 (22%)
Ig_2 307..379 CDD:290606 27/88 (31%)
I-set 382..462 CDD:254352 1/2 (50%)
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.