DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and rst

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001284835.1 Gene:rst FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster

Alignment Length:379 Identity:81/380 (21%)
Similarity:123/380 (32%) Gaps:119/380 (31%)


  Fly   109 VVEEPEFTEY--------IENVTVPAGRNVKLGCSVKN-------------LGSYKVAWMHFEQS 152
            :|....:|.|        .::.|...|..|.|.|.|.|             ||:.: ....||:.
  Fly    16 MVRSSPYTSYQNQRFAMEPQDQTAVVGARVTLPCRVINKQGTLQWTKDDFGLGTSR-DLSGFERY 79

  Fly   153 AILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQIN-----TVTAKTQFGYL 212
            |::                  ..|....:.|.|..|..:|..||.||::     ....::.|..|
  Fly    80 AMV------------------GSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGL 126

  Fly   213 NVVVPPNIDDSLSSSDVI-VREGANISLRC-RASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGD 275
            .|:|||.. ..::..||| ..|...:.:.| ...|.|...|.| .|....:..           |
  Fly   127 TVLVPPEA-PKITQGDVIYATEDRKVEIECVSVGGKPAAEITW-IDGLGNVLT-----------D 178

  Fly   276 TLEITRISRLDMGAYL-------------------CIASNGVPPTV-SKRIKVSVDFPPMLLI-- 318
            .:|.|.|...|...:.                   |.|.|....|. |.:|:|.|.:.|.:.:  
  Fly   179 NIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYAPKVKVNV 243

  Fly   319 -------------------PHQLVGA--PEGFNVTIECFTEAHPTSLNY-WTRGEGPIIHDSHKY 361
                               .|...|:  .|...|.:||..:|:|:.:.| |...:.|||...   
  Fly   244 MGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFINDEPIIGGQ--- 305

  Fly   362 KVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPT 415
            |.|..:.....|.|            |.|.||..:|..|:::....|.:||.|:
  Fly   306 KTEMVIRNVTRKFH------------DAIVKCEVQNSVGKSEDSETLDISYAPS 347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 24/114 (21%)
Ig 130..200 CDD:143165 19/83 (23%)
I-set 226..310 CDD:254352 22/106 (21%)
IGc2 233..298 CDD:197706 15/85 (18%)
Ig 313..410 CDD:299845 25/121 (21%)
IG_like 325..410 CDD:214653 22/88 (25%)
rstNP_001284835.1 IG_like 34..130 CDD:214653 24/115 (21%)
Ig 42..114 CDD:299845 20/91 (22%)
C2-set_2 135..225 CDD:285423 19/102 (19%)
Ig_3 265..329 CDD:290638 20/79 (25%)
I-set 346..420 CDD:254352 1/3 (33%)
Ig 360..425 CDD:299845
Ig5_KIRREL3-like 428..524 CDD:143235
IG_like 435..524 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.