DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Ccdc141

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_006224692.1 Gene:Ccdc141 RGDID:1593250 Length:1578 Species:Rattus norvegicus

Alignment Length:320 Identity:59/321 (18%)
Similarity:97/321 (30%) Gaps:116/321 (36%)


  Fly   242 RASGSPRPIIKWKRDDNSRIAINKNHIVNE-WEGDTLEITRISRLDMGAYLCIASNGVPPTVSKR 305
            :|.|:....|...|:|...:.:.::....: .:|.||....:|..|..   ||:|:         
  Rat  1160 QAQGADVSAINGTREDGLPVGLRQSFDKEDSAQGLTLPEDTLSGEDSE---CISSD--------- 1212

  Fly   306 IKVSVDFPPMLLIPHQ---------------------------------LVGAPEGFNVTIECFT 337
               .:..||:.:.|..                                 |..|||........||
  Rat  1213 ---DISLPPLPVTPESPLAPSDMEVEEPASSSALALHISGYRMRTGTGGLGKAPESVLPPPTAFT 1274

  Fly   338 EAHPTSLNYWTRGEGPIIHDSH------KYKVEATV-----GLPAYKTHMKLTIINVSSGDDGIY 391
            :.:....:.:|         ||      ::|.|..:     |..:.|.|     :||        
  Rat  1275 DGYHNKKDTFT---------SHFERPYPQFKAEPLLTSRGSGEMSTKLH-----VNV-------- 1317

  Fly   392 KCVAKNPRGETDGIIRLYVSYPPTTASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKNTR 456
            ||.|:.||...|..:      ||::.:..| |..|.                  ..::|....|:
  Rat  1318 KCPARMPREVHDKAL------PPSSQAQEI-SLGTQ------------------EKVHADSNVTK 1357

  Fly   457 YQSNLNEI-----GLSEQKSFLDKTQNPLLANGNANEADAESN--GARGHNP--SMAIAW 507
            .|..|:..     |||.|.......|..:...|:...:.||.:  ...|..|  |..:.|
  Rat  1358 TQDRLHAALDVSPGLSSQSDTSRSHQRQVGPQGDRKNSSAEKSVVSLAGQAPHFSRLLLW 1417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653
Ig 130..200 CDD:143165
I-set 226..310 CDD:254352 13/69 (19%)
IGc2 233..298 CDD:197706 13/57 (23%)
Ig 313..410 CDD:299845 25/141 (18%)
IG_like 325..410 CDD:214653 21/96 (22%)
Ccdc141XP_006224692.1 SPEC 132..356 CDD:238103
SbcC <219..804 CDD:223496
SPEC 260..458 CDD:295325
Ig <1491..1547 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.