DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Kirrel1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_006232737.1 Gene:Kirrel1 RGDID:727883 Length:805 Species:Rattus norvegicus

Alignment Length:431 Identity:101/432 (23%)
Similarity:158/432 (37%) Gaps:89/432 (21%)


  Fly   112 EPEFTEYIENVTVPAGRNVKLGCSVKN---------------LGSYKVAWMHFEQSAILTVHNHV 161
            :..|::...:.||.||....|.|.:.|               :|....||               
  Rat    52 QTRFSQEPADQTVVAGHRAVLPCVLLNYSGIVQWTKDGLALGMGQGLKAW--------------- 101

  Fly   162 ITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSS 226
                ||..|........  :.|.|.:....|...|.||......:::...|.|::||. |..:..
  Rat   102 ----PRYRVVGSADAGQ--YNLEITDAELSDDASYECQATEAALRSRRAKLTVLIPPE-DTRIDG 159

  Fly   227 SDVI-VREGANISLRCRA-SGSPRPIIKWKRDDNSRI-AINKNHIVNEWEGDTLEITRI----SR 284
            ..|| ::.|...:|.||| :..|...|.|.||...:. |:....::.:.:.:| .|:::    :.
  Rat   160 GPVILLQAGTPYNLTCRAFNAKPAATIIWFRDGTQQEGAVTSTELLKDGKRET-TISQLLIQPTD 223

  Fly   285 LDMG-AYLCIASN-GVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNY- 346
            ||:| .:.|.:.| .:|......|::.|..||.:.:..:.....||..|...|...|:|..|.| 
  Rat   224 LDIGRVFTCRSMNEAIPNGKETSIELDVHHPPTVTLSIEPQTVLEGERVIFTCQATANPEILGYR 288

  Fly   347 WTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIIN-VSSGDDGIYKCVAKNPRGETDGIIRLYV 410
            |.:| |.:|.|:|:.:.|..|....:...:...:.| |.|.:......|...||         .|
  Rat   289 WAKG-GFLIEDAHESRYETNVDYSFFTEPVSCEVYNKVGSTNVSTLVNVHFAPR---------IV 343

  Fly   411 SYP-PTTASSGIYSTDT-HWGENGINNNYAYGGPDSTRSIYAQDKN--TRYQSNLNEIGLSEQKS 471
            .|| |||...|...|.| .|          .|.|..|.:...:|.|  .|...:..|..||.|  
  Rat   344 VYPKPTTTDIGSDVTLTCVW----------VGNPPLTLTWTKKDSNMGPRLPGSPPEANLSAQ-- 396

  Fly   472 FLDKTQNPLLANGN------ANEADAESNGARGHNPSMAIA 506
                    :|:|.|      ..:|||.:...|...|.:.:|
  Rat   397 --------VLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVA 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 21/111 (19%)
Ig 130..200 CDD:143165 15/85 (18%)
I-set 226..310 CDD:254352 22/93 (24%)
IGc2 233..298 CDD:197706 18/73 (25%)
Ig 313..410 CDD:299845 24/99 (24%)
IG_like 325..410 CDD:214653 22/87 (25%)
Kirrel1XP_006232737.1 I-set 54..148 CDD:254352 21/115 (18%)
Ig 57..148 CDD:299845 20/112 (18%)
Ig2_KIRREL3-like 170..251 CDD:143236 19/82 (23%)
I-set 255..336 CDD:254352 20/82 (24%)
Ig_2 259..337 CDD:290606 20/79 (25%)
Ig_2 340..437 CDD:290606 31/120 (26%)
IG_like 346..437 CDD:214653 27/105 (26%)
Ig5_KIRREL3 439..536 CDD:143306
IG_like 451..536 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.