DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Iglon5

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_218634.5 Gene:Iglon5 RGDID:1305344 Length:336 Species:Rattus norvegicus

Alignment Length:325 Identity:93/326 (29%)
Similarity:142/326 (44%) Gaps:38/326 (12%)


  Fly    92 VIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILT 156
            ::.|...|.:...:..::.:..||:...:|.||..|.|..|.|.:....: :|||::  :|.||.
  Rat    12 LLAAAALAGLAVISRGLLSQSLEFSSPADNYTVCEGDNATLSCFIDEHVT-RVAWLN--RSNILY 73

  Fly   157 VHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINT--VTAKTQFGYLNVVVPPN 219
            ..|...|.:||:.:..:..:.   :.:.|..|...|.|.|.|...|  ....||. ||.|.||..
  Rat    74 AGNDRWTSDPRVRLLINTPEE---FSILITQVGLGDEGLYTCSFQTRHQPYTTQV-YLIVHVPAR 134

  Fly   220 IDDSLSSSDVIVREGANISLRCRASGSPRPIIKWK--RDDNSRIAINKNHIVNEWEGDTLEITRI 282
            |.:  .||.|.|.||.|::|.|.|.|.|.|.:.|:  ||..:.            ||:.|||:.|
  Rat   135 IVN--ISSPVAVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTS------------EGEILEISDI 185

  Fly   283 SRLDMGAYLCIASNGVPPTV-SKRIKVSVDFPPMLLIPHQLVGAPE--GFNVTIECFTEAHPTSL 344
            .|...|.|.|:..|||.... |:|:.|:|::||.:.   .:..|..  |....:.|...|.|.:.
  Rat   186 QRGQAGEYECVTHNGVNSAPDSRRVLVTVNYPPTIT---DVTSARTALGRAALLRCEAMAVPPAD 247

  Fly   345 NYWTRGEGPIIHDSHK-YKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRL 408
            ..|.:.:..:...|.: .||:..      :|...|...|||:...|.|.|.|.|..|.:...:||
  Rat   248 FQWYKDDRLLSSGSAEGLKVQTE------RTRSMLLFANVSARHYGNYTCRAANRLGASSASMRL 306

  Fly   409  408
              Rat   307  306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 29/98 (30%)
Ig 130..200 CDD:143165 18/70 (26%)
I-set 226..310 CDD:254352 32/87 (37%)
IGc2 233..298 CDD:197706 24/67 (36%)
Ig 313..410 CDD:299845 24/100 (24%)
IG_like 325..410 CDD:214653 22/88 (25%)
Iglon5XP_218634.5 Ig 41..129 CDD:325142 28/95 (29%)
Ig_3 134..199 CDD:316449 27/79 (34%)
Ig_3 217..295 CDD:316449 20/87 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80554944
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4484
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 1 1.000 T131101
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.617 Consistency score
TreeFam 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.