DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and Igsf9

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001100667.1 Gene:Igsf9 / 304982 RGDID:1304566 Length:1179 Species:Rattus norvegicus


Alignment Length:335 Identity:84/335 - (25%)
Similarity:141/335 - (42%) Gaps:55/335 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EPEFTEYIENVTVPAGRNVKLGCSVKNLGS----YKVAWMHFEQSAILTVHNHVITRNPRISVTH 172
            :||    :.:|...||.:..|||.:.....    :.:.|:.|  ..:|.:.......:|||...:
  Rat    23 KPE----VVSVVGRAGESAVLGCDLLPPAGRPPLHVIEWLRF--GFLLPIFIQFGLYSPRIDPDY 81

  Fly   173 DKHDRHRTW-YLHINNVHEEDRGRYMCQINTVT--------AKTQFGYLNVVVPPNIDDSLSSSD 228
            ....|.:|. .|.|..:..||:|.|.|::..:.        |...:.:|.|..||...:: ....
  Rat    82 VGRVRLQTGASLQIEGLRVEDQGWYECRVLFLDQHSPEQDFANGSWVHLTVNSPPQFQET-PPLV 145

  Fly   229 VIVREGANISLRCRASGSPRPIIKWK-RDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLC 292
            :.|:|...::|||.|.|||:|.:.|| |..:    :.|.....:....||.|.|:.|...|.|.|
  Rat   146 LEVKELEAVTLRCVALGSPQPYVTWKFRGQD----LGKGQGQVQVRNGTLWIRRVERGSAGDYTC 206

  Fly   293 IASNGVPPTVSKRIKVSVDFPPMLLIP--HQLVGAPEGFNVTIECFTEAHPTSLNY-WTRGEGPI 354
            .||: ...:|:...::.|..||::::|  :..|.|.:  :|::.|..||:|.:|.| |.:....:
  Rat   207 QASS-TEGSVTHTTQLLVLGPPVIVVPPNNNTVNASQ--DVSLACRAEAYPANLTYSWFQDRINV 268

  Fly   355 IHDSH-----KYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKN----PRGETDGIIRLYV 410
            .|.|.     :..|:.::.|.|           ....|.|.|.||..|    |...:..:..||.
  Rat   269 FHISRLQSRVRILVDGSLWLQA-----------TQPDDAGHYTCVPSNGFPHPPSASAYLTVLYP 322

  Fly   411 S----YPPTT 416
            :    .||.|
  Rat   323 AQVTVMPPET 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 24/108 (22%)
Ig 130..200 CDD:143165 18/74 (24%)
I-set 226..310 CDD:254352 25/84 (30%)
IGc2 233..298 CDD:197706 23/65 (35%)
Ig 313..410 CDD:299845 26/108 (24%)
IG_like 325..410 CDD:214653 22/94 (23%)
Igsf9NP_001100667.1 IG 28..110 CDD:214652 21/83 (25%)
Ig strand A 136..139 CDD:409353 1/2 (50%)
IG_like 143..223 CDD:214653 25/84 (30%)
Ig strand A' 145..148 CDD:409353 0/2 (0%)
Ig strand B 154..161 CDD:409353 3/6 (50%)
Ig strand C 167..172 CDD:409353 1/4 (25%)
Ig strand C' 175..177 CDD:409353 0/5 (0%)
Ig strand D 183..187 CDD:409353 0/3 (0%)
Ig strand E 189..193 CDD:409353 2/3 (67%)
Ig strand F 202..210 CDD:409353 4/7 (57%)
Ig strand G 213..223 CDD:409353 1/9 (11%)
Ig_3 226..305 CDD:404760 23/91 (25%)
putative Ig strand A 226..230 CDD:409353 2/3 (67%)
putative Ig strand A' 235..239 CDD:409353 0/3 (0%)
putative Ig strand B 241..251 CDD:409353 2/11 (18%)
putative Ig strand C' 267..270 CDD:409353 0/2 (0%)
putative Ig strand D 279..282 CDD:409353 0/2 (0%)
putative Ig strand E 284..290 CDD:409353 1/5 (20%)
putative Ig strand F 297..305 CDD:409353 4/7 (57%)
putative Ig strand G 310..319 CDD:409353 1/8 (13%)
Ig 322..407 CDD:416386 3/11 (27%)
Ig strand A' 324..328 CDD:409353 0/3 (0%)
Ig strand B 333..347 CDD:409353 84/335 (25%)
Ig strand C 353..359 CDD:409353
Ig strand C' 362..364 CDD:409353
Ig strand D 371..374 CDD:409353
Ig strand E 378..382 CDD:409353
Ig strand F 391..399 CDD:409353
Ig 418..503 CDD:416386
Ig strand A 418..421 CDD:409353
Ig strand A' 427..430 CDD:409353
Ig strand B 436..443 CDD:409353
Ig strand C 449..454 CDD:409353
Ig strand C' 457..459 CDD:409353
Ig strand D 462..466 CDD:409353
Ig strand E 469..473 CDD:409353
Ig strand F 482..490 CDD:409353
Ig strand G 493..503 CDD:409353
FN3 508..599 CDD:238020
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 766..807
PHA03247 <777..1062 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 819..846
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 869..895
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 942..979
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1016..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.