DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Igsf9

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_008767962.1 Gene:Igsf9 RGDID:1304566 Length:1201 Species:Rattus norvegicus

Alignment Length:335 Identity:84/336 (25%)
Similarity:141/336 (42%) Gaps:55/336 (16%)


  Fly   112 EPEFTEYIENVTVPAGRNVKLGCSVKNLGS----YKVAWMHFEQSAILTVHNHVITRNPRISVTH 172
            :||    :.:|...||.:..|||.:.....    :.:.|:.|  ..:|.:.......:|||...:
  Rat    23 KPE----VVSVVGRAGESAVLGCDLLPPAGRPPLHVIEWLRF--GFLLPIFIQFGLYSPRIDPDY 81

  Fly   173 DKHDRHRTW-YLHINNVHEEDRGRYMCQINTVT--------AKTQFGYLNVVVPPNIDDSLSSSD 228
            ....|.:|. .|.|..:..||:|.|.|::..:.        |...:.:|.|..||...:: ....
  Rat    82 VGRVRLQTGASLQIEGLRVEDQGWYECRVLFLDQHSPEQDFANGSWVHLTVNSPPQFQET-PPLV 145

  Fly   229 VIVREGANISLRCRASGSPRPIIKWK-RDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLC 292
            :.|:|...::|||.|.|||:|.:.|| |..:    :.|.....:....||.|.|:.|...|.|.|
  Rat   146 LEVKELEAVTLRCVALGSPQPYVTWKFRGQD----LGKGQGQVQVRNGTLWIRRVERGSAGDYTC 206

  Fly   293 IASNGVPPTVSKRIKVSVDFPPMLLIP--HQLVGAPEGFNVTIECFTEAHPTSLNY-WTRGEGPI 354
            .||: ...:|:...::.|..||::::|  :..|.|.:  :|::.|..||:|.:|.| |.:....:
  Rat   207 QASS-TEGSVTHTTQLLVLGPPVIVVPPNNNTVNASQ--DVSLACRAEAYPANLTYSWFQDRINV 268

  Fly   355 IHDSH-----KYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKN----PRGETDGIIRLYV 410
            .|.|.     :..|:.::.|.|           ....|.|.|.||..|    |...:..:..||.
  Rat   269 FHISRLQSRVRILVDGSLWLQA-----------TQPDDAGHYTCVPSNGFPHPPSASAYLTVLYP 322

  Fly   411 S----YPPTT 416
            :    .||.|
  Rat   323 AQVTVMPPET 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 24/109 (22%)
Ig 130..200 CDD:143165 18/75 (24%)
I-set 226..310 CDD:254352 25/85 (29%)
IGc2 233..298 CDD:197706 23/66 (35%)
Ig 313..410 CDD:299845 27/109 (25%)
IG_like 325..410 CDD:214653 23/95 (24%)
Igsf9XP_008767962.1 Ig 24..132 CDD:299845 25/114 (22%)
IG_like 28..110 CDD:214653 21/84 (25%)
IG_like 143..223 CDD:214653 25/85 (29%)
Ig 154..220 CDD:143165 23/71 (32%)
Ig_3 226..305 CDD:290638 23/92 (25%)
IG_like 233..319 CDD:214653 22/99 (22%)
Ig 341..407 CDD:299845
FN3 <577..621 CDD:238020
FN3 647..737 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.