DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and ncam1a

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_009293555.1 Gene:ncam1a ZFINID:ZDB-GENE-990415-31 Length:1010 Species:Danio rerio

Alignment Length:270 Identity:68/271 (25%)
Similarity:110/271 (41%) Gaps:43/271 (16%)


  Fly   167 RISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIV 231
            |:.|..:.|       |.|..:.:.|.|.|.|: ..:.|:.:.....:.|..|:..|:.:....:
Zfish   162 RLKVLSNNH-------LQIRGIKKTDEGDYTCE-GRIMARGEIDLRV
IKVIVNVLPSIRTRYTEL 218

  Fly   232 REGANI----SLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLC 292
            ...|:|    :|.|.|.|.|.|.:||.| .|:.:..::.:.:|| :|..|.|..:::||.|.|.|
Zfish   219 NATADINQAVTLACHADGYPEPTVKWAR-GNTELESDEKYSLNE-DGSELTIKDVNKLDEGDYKC 281

  Fly   293 IASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIEC------------------FTEA 339
            ||.|..... |:.:.::|...|.:........:.....:|:.|                  |||.
Zfish   282 IARNKAGER-SEEVTLNVFVQPKITFLENQTASELEEQITLTCEATGDPTPNIIWSFGRRVFTEN 345

  Fly   340 HPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDG 404
            ...|   |||.|      .|| .::..|.:.:......||:..|...|.|.|.|.|:|..|:...
Zfish   346 EQAS---WTRPE------KHK-SLDGNVVVRSDARVSSLTLKYVQFTDAGQYLCTARNSIGQDIQ 400

  Fly   405 IIRLYVSYPP 414
            .:.|.|.|.|
Zfish   401 SMYLEVRYAP 410

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 10/49 (20%)
Ig 130..200 CDD:143165 9/33 (27%)
I-set 226..310 CDD:254352 26/88 (30%)
IGc2 233..298 CDD:197706 25/69 (36%)
Ig 313..410 CDD:299845 25/115 (22%)
IG_like 325..410 CDD:214653 24/103 (23%)
ncam1aXP_009293555.1 Ig 20..112 CDD:299845
I-set 21..111 CDD:254352
IG_like 121..200 CDD:214653 10/46 (22%)
IGc2 128..189 CDD:197706 9/35 (26%)
Ig 208..301 CDD:299845 28/96 (29%)
IG_like 219..298 CDD:214653 26/82 (32%)
Ig 300..406 CDD:299845 25/116 (22%)
IG_like 308..406 CDD:214653 24/108 (22%)
ig 413..498 CDD:278476
IG_like 415..498 CDD:214653
fn3 505..589 CDD:278470
FN3 624..715 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.