DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Lsamp

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_006248401.1 Gene:Lsamp RGDID:71102 Length:361 Species:Rattus norvegicus

Alignment Length:355 Identity:110/356 (31%)
Similarity:163/356 (46%) Gaps:47/356 (13%)


  Fly   101 VPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRN 165
            :||   .:.|...:|....:|:||..|....|.|.|::..| ||||::  :|.|:...:...:.:
  Rat    23 LPT---GLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNS-KVAWLN--RSGIIFAGHDKWSLD 81

  Fly   166 PRISVTHDKHDRHRTWY-LHINNVHEEDRGRYMCQINTV-TAKTQFGYLNVVVPPNIDDSLSSSD 228
            ||:.:    ..||...| |.|..|...|.|.|.|.:.|. ..||...||.|.|||.|  |..|||
  Rat    82 PRVEL----EKRHALEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKI--SNISSD 140

  Fly   229 VIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIV---NEWEGDT--LEITRISRLDMG 288
            |.|.||:|::|.|.|:|.|.|:|.|:            |:.   .|:||:.  |||..|:|...|
  Rat   141 VTVNEGSNVTLVCMANGRPEPVITWR------------HLTPLGREFEGEEEYLEILGITREQSG 193

  Fly   289 AYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGP 353
            .|.|.|:|.|.....|::||:|::|| .:...:...|..|...:::|...|.|.....|.| :..
  Rat   194 KYECKAANEVSSADVKQVKVTVNYPP-TITESKSNEATTGRQASLKCEASAVPAPDFEWYR-DDT 256

  Fly   354 IIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTAS 418
            .|:.::..::::|.|      ...||:.||:....|.|.|||.|..|.|:..:.|:....||...
  Rat   257 RINSANGLEIKSTEG------QSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTVPH 315

  Fly   419 SGIYSTDTHWGENGINNNYAYGGPDSTRSI 448
            .        ..|.|...::...||.|.|.|
  Rat   316 P--------IQEIGTTVHFKQKGPGSVRGI 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 32/98 (33%)
Ig 130..200 CDD:143165 22/71 (31%)
I-set 226..310 CDD:254352 34/89 (38%)
IGc2 233..298 CDD:197706 25/70 (36%)
Ig 313..410 CDD:299845 25/97 (26%)
IG_like 325..410 CDD:214653 23/85 (27%)
LsampXP_006248401.1 Ig 38..128 CDD:299845 31/97 (32%)
IG_like 40..128 CDD:214653 31/95 (33%)
I-set 132..215 CDD:254352 37/97 (38%)
IGc2 145..204 CDD:197706 26/71 (37%)
I-set 218..305 CDD:254352 24/95 (25%)
IGc2 232..297 CDD:197706 19/72 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80608990
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4484
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 1 1.000 T131101
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.