DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and Ncam2

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_981954.2 Gene:Ncam2 / 288280 RGDID:1303131 Length:837 Species:Rattus norvegicus


Alignment Length:477 Identity:114/477 - (23%)
Similarity:179/477 - (37%) Gaps:110/477 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SWHLIGALL-----VLAATAGDSTNKIILPQILNGGGGGGGVG-------TAQGK-------HPS 50
            |::|:|.|:     :|..|.  |.:|:.|           .||       ||.|:       :|.
  Rat     6 SFYLLGLLVSSGQALLQVTI--SLSKVEL-----------SVGESKFFTCTAIGEPESIDWYNPQ 57

  Fly    51 GSKTVATGVVPNFGGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGG-------GANVPTSNLNI 108
            |.|.::|..|               .:...|..|.:...|..|...|       .|...|....:
  Rat    58 GEKIISTQRV---------------MLQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATV 107

  Fly   109 VVE---EPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNP--RI 168
            |:|   :..|.|.:.......|.:.::.|.|.:..:..|:|::         ||..:|..|  |.
  Rat   108 VLEIYQKLTFREVLSPQEFKQGEDAEVVCRVSSSPAPAVSWLY---------HNEEVTTIPDNRF 163

  Fly   169 SVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVV----VPPNIDDSLSSSDV 229
            :|..:.:       |.|.|:::.|.|.|.|: ..|.|:.:..:.:::    |||.|.....|.:.
  Rat   164 AVLANNN-------LQILNINKSDEGIYRCE-GRVEARGEIDFRDIIVIVNVPPAIVMPQKSFNA 220

  Fly   230 IVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEIT--RISRLDMGAYLC 292
            ....|..::|.|:|||||.|.|.|.| :...|..|:.:|:   :|...|:|  .|...|.|:|:|
  Rat   221 TAERGEEMTLTCKASGSPDPAISWFR-NGKLIEENEKYIL---KGSNTELTVRNIINKDGGSYVC 281

  Fly   293 IASNGVPPTVSKRIKVSVD----FPPMLLIPH--QLVG--APEGFNVTIECFTEAHPTSLNYWTR 349
            .|:|          |...|    |..:.:.||  ||..  ..|..:||:.|..|..|.....|.|
  Rat   282 KATN----------KAGEDQKQAFLQVFVQPHILQLKNETTSENGHVTLICEAEGEPVPEITWKR 336

  Fly   350 GEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPP 414
            ....:.........:..:.:........|.|.:|...|.|.|.|.|.:..|.....:.|.:.|.|
  Rat   337 AIDGVTFSEGDKSPDGRIEVKGQHGRSSLHIRDVKLSDSGRYDCEAASRIGGHQRSMHLDIEYAP 401

  Fly   415 TTASSG--IYSTDTHWGENGIN 434
            ...|:.  .||    |..|.||
  Rat   402 KFVSNQTMYYS----WEGNPIN 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/101 (20%)
Ig strand B 130..134 CDD:409405 0/3 (0%)
Ig strand C 143..147 CDD:409405 1/3 (33%)
Ig strand E 178..185 CDD:409405 1/6 (17%)
IgI_1_MuSK 218..310 CDD:409562 29/93 (31%)
Ig strand A 218..221 CDD:409562 1/2 (50%)
Ig strand A' 226..231 CDD:409562 1/4 (25%)
Ig strand B 237..244 CDD:409562 2/6 (33%)
Ig strand C 250..255 CDD:409562 2/4 (50%)
Ig strand C' 257..259 CDD:409562 0/1 (0%)
Ig strand D 267..270 CDD:409562 1/2 (50%)
Ig strand E 275..281 CDD:409562 2/7 (29%)
Ig strand F 288..295 CDD:409562 3/6 (50%)
Ig strand G 302..310 CDD:409562 1/7 (14%)
IG_like 325..410 CDD:214653 18/84 (21%)
Ig strand B 331..335 CDD:143207 2/3 (67%)
Ig strand C 344..348 CDD:143207 0/3 (0%)
Ig strand E 376..380 CDD:143207 1/3 (33%)
Ig strand F 390..395 CDD:143207 2/4 (50%)
Ig strand G 403..406 CDD:143207 0/2 (0%)
Ncam2NP_981954.2 IgI_1_NCAM-2 21..113 CDD:409452 24/119 (20%)
Ig strand A 21..26 CDD:409452 2/6 (33%)
Ig strand A' 29..33 CDD:409452 2/14 (14%)
Ig strand B 35..45 CDD:409452 2/9 (22%)
Ig strand C 49..55 CDD:409452 0/5 (0%)
Ig strand C' 58..60 CDD:409452 1/1 (100%)
Ig strand D 66..72 CDD:409452 1/20 (5%)
Ig strand E 74..82 CDD:409452 1/7 (14%)
Ig strand F 89..96 CDD:409452 1/6 (17%)
Ig strand G 101..112 CDD:409452 3/10 (30%)
Ig 117..193 CDD:472250 21/92 (23%)
Ig strand B 132..136 CDD:409353 0/3 (0%)
Ig strand C 145..152 CDD:409353 2/15 (13%)
Ig strand E 169..173 CDD:409353 1/10 (10%)
Ig strand F 183..187 CDD:409353 1/3 (33%)
Ig strand G 191..194 CDD:409353 1/2 (50%)
IgI_1_MuSK 209..298 CDD:409562 31/102 (30%)
Ig strand A 209..212 CDD:409562 1/2 (50%)
Ig strand A' 217..222 CDD:409562 1/4 (25%)
Ig strand B 228..235 CDD:409562 2/6 (33%)
Ig strand C 241..246 CDD:409562 2/4 (50%)
Ig strand C' 248..250 CDD:409562 0/1 (0%)
Ig strand D 257..260 CDD:409562 1/5 (20%)
Ig strand E 264..270 CDD:409562 2/5 (40%)
Ig strand F 277..284 CDD:409562 3/6 (50%)
Ig strand G 290..298 CDD:409562 2/7 (29%)
Ig 300..397 CDD:472250 22/96 (23%)
Ig strand B 318..322 CDD:409353 2/3 (67%)
Ig strand C 331..335 CDD:409353 0/3 (0%)
Ig strand E 363..367 CDD:409353 1/3 (33%)
Ig strand F 377..382 CDD:409353 2/4 (50%)
Ig strand G 390..393 CDD:409353 0/2 (0%)
Ig_3 401..479 CDD:464046 8/23 (35%)
FN3 496..588 CDD:238020
fn3 594..678 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.