DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and CCDC141

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_011509293.1 Gene:CCDC141 HGNCID:26821 Length:1558 Species:Homo sapiens

Alignment Length:146 Identity:29/147 (20%)
Similarity:56/147 (38%) Gaps:40/147 (27%)


  Fly   137 KNLGSYKVAWMHFEQSAILTVHNHVITRNPR----ISVTHDKHDRHRTWYLHINNVHEEDRGRYM 197
            |:...::::..| .:|.:..||...:.::|:    :..|.:|        :|.:|...:.:.|..
Human  1308 KSTALHRISAEH-PESMMSEVHERALQQHPQAQGGLLETREK--------MHADNNFTKTQDRLH 1363

  Fly   198 CQINTVT-----AKTQFGYLNVVVP--------------------PNIDDSLSSSDVIVREGANI 237
            ...:..:     :.|..||...:||                    ||....|  |:|.|.||:.:
Human  1364 ASSDAFSGLRFQSGTSRGYQRQMVPREEIKSTSAKSSVVSLADQAPNFSRLL--SNVTVMEGSPV 1426

  Fly   238 SLRCRASGSPRPIIKW 253
            :|....:|.|.|.:.|
Human  1427 TLEVEVTGFPEPTLTW 1442

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 14/88 (16%)
Ig 130..200 CDD:143165 11/67 (16%)
I-set 226..310 CDD:254352 10/29 (34%)
IGc2 233..298 CDD:197706 7/22 (32%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
CCDC141XP_011509293.1 SPEC 132..356 CDD:238103
SMC_prok_B 221..>846 CDD:274008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.