DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and PRTG

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_776175.2 Gene:PRTG HGNCID:26373 Length:1150 Species:Homo sapiens

Alignment Length:426 Identity:96/427 (22%)
Similarity:160/427 (37%) Gaps:83/427 (19%)


  Fly    99 ANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVIT 163
            |::..|.::....:|..||      |..|...:..|.:.:.....:.| .|.::.          
Human   127 AHLALSTISAFEVQPISTE------VHEGGVARFACKISSHPPAVITW-EFNRTT---------- 174

  Fly   164 RNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSD 228
                :.:|.|:.....|..|.|.:|.:.|.|.|.|...||..:.:....::.|.|..:.....:.
Human   175 ----LPMTMDRITALPTGVLQIYDVSQRDSGNYRCIAATVAHRRKSMEASLTVIPAKESKSFHTP 235

  Fly   229 VIVREGANIS--------LRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRL 285
            .|:....||:        |.|.|:|:|:|||.|.|.|:..|.:....::.   ...|.|:.:...
Human   236 TIIAGPQNITTSLHQTVVLECMATGNPKPIISWSRLDHKSIDVFNTRVLG---NGNLMISDVRLQ 297

  Fly   286 DMGAYLCIASNGVPPTVSKRI---KVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYW 347
            ..|.|:|.|:  .|.|.:..:   .::|..||..:...:.:..|........|..|..|:....|
Human   298 HAGVYVCRAT--TPGTRNFTVAMATLTVLAPPSFVEWPESLTRPRAGTARFVCQAEGIPSPKMSW 360

  Fly   348 TRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRL---- 408
            .: .|..||.:.:.|:        |.:  ||.|..:...||.||:|:|:|.:|......||    
Human   361 LK-NGRKIHSNGRIKM--------YNS--KLVINQIIPEDDAIYQCMAENSQGSILSRARLTVVM 414

  Fly   409 --------YVSYPPTTASSGI--------YSTD------THWGE-NGINNN--YAYGGPDSTRSI 448
                    |..:..|.:||.|        |::|      .|:.: .|:||.  ....|.|:|..|
Human   415 SEDRPSAPYNVHAETMSSSAILLAWERPLYNSDKVIAYSVHYMKAEGLNNEEYQVVIGNDTTHYI 479

  Fly   449 Y----AQDKNTRYQSNLNEIGLSEQKSFLDKTQNPL 480
            .    .....|.|......:|.|:....:  |||.|
Human   480 IDDLEPASNYTFYIVAYMPMGASQMSDHV--TQNTL 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 17/96 (18%)
Ig 130..200 CDD:143165 13/70 (19%)
I-set 226..310 CDD:254352 23/95 (24%)
IGc2 233..298 CDD:197706 20/73 (27%)
Ig 313..410 CDD:299845 26/109 (24%)
IG_like 325..410 CDD:214653 24/97 (25%)
PRTGNP_776175.2 Ig 40..130 CDD:299845 1/3 (33%)
Ig 139..223 CDD:299845 20/105 (19%)
IG_like 141..223 CDD:214653 20/103 (19%)
IG_like 241..323 CDD:214653 22/87 (25%)
IGc2 250..309 CDD:197706 18/64 (28%)
I-set 327..412 CDD:254352 24/96 (25%)
Ig 345..412 CDD:299845 22/78 (28%)
FN3 419..512 CDD:238020 22/95 (23%)
FN3 517..610 CDD:238020
fn3 624..699 CDD:278470
FN3 726..814 CDD:238020
FN3 821..911 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.