DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Dscam4

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001261571.1 Gene:Dscam4 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster

Alignment Length:507 Identity:120/508 (24%)
Similarity:183/508 (36%) Gaps:124/508 (24%)


  Fly   103 TSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAW----------MHFEQSAILTV 157
            |:.|.:....||...:....|:..|..|.|.|........:..|          ..|.....:|:
  Fly   412 TAELQLGDASPELLYWFSEQTLQPGPTVSLKCVATGNPLPQFTWSLDGFPIPDSSRFLVGQYVTI 476

  Fly   158 HNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQI-NTVTAKTQFGYLNVVVPPNID 221
            |:.||:                  :::|:||.|||.|.|.|.. |.:...:....:|:...|.|.
  Fly   477 HDDVIS------------------HVNISNVKEEDGGEYTCTAQNAIGKVSHSAKVNIYGLPYIR 523

  Fly   222 D-----SLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITR 281
            :     .:|.||:||        :|..:|.|...|.|:||..: :.||:..  ..:...||.|.:
  Fly   524 EMPKITGISGSDLIV--------KCPVAGYPIDKIHWERDGQT-LPINRRQ--RAYNNGTLIIEQ 577

  Fly   282 ISRL-DMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVG--APEGFNVTIEC-FTEAH-P 341
            :.|| |.|.|.|:|.|....|..:.:::.|..||.:: |.|.:.  ..||....|.| ..|.. |
  Fly   578 LQRLEDAGTYTCMAQNKQKQTSRRNVEIQVLVPPKIM-PIQAMTNMLREGMRAAISCQILEGDLP 641

  Fly   342 TSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGII 406
            .|.. |.|...|:|...:    |....|..|..  .|.|.::||...|.|.|:|.|..|.....:
  Fly   642 VSFR-WERNGKPLIGTGN----EVFRRLDEYSA--SLVIEHISSDHSGNYTCIASNVAGTERFTV 699

  Fly   407 RLYVSYPP--------TTASSGI----------YSTDTHWGENGIN------NNYAYGG-----P 442
            .|.|:.||        ::|.:|.          |.|.|...:..|.      .::.|..     |
  Fly   700 PLTVNVPPKWILEPKDSSAQAGADVLLHCQSSGYPTPTITWKKAIGPTPGEYKDFLYEPTVQLFP 764

  Fly   443 DSTRSIYAQDKNTRYQSNL-----NEIGLSEQK----------SFLDKTQNPLLANGNANEADAE 492
            :.|  |:.:..:...|.:.     |.||....|          .|..||:...:|.|  .:...:
  Fly   765 NGT--IFFKKISKESQGHFLCEAKNNIGSGVSKVIFLKVNVPAHFQTKTKQISVAKG--KQVHVQ 825

  Fly   493 SNGARGHNPSMAIAWLFVVIATLL-------LTIR---------SAVGSSHS 528
            .| .:|.|| :...|........|       .|||         |.:|.||:
  Fly   826 CN-VQGDNP-IDFKWKIQATQQYLDESLDSRYTIRDQVLDDGMVSELGISHT 875

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/107 (21%)
Ig 130..200 CDD:143165 18/80 (23%)
I-set 226..310 CDD:254352 25/85 (29%)
IGc2 233..298 CDD:197706 20/66 (30%)
Ig 313..410 CDD:299845 29/101 (29%)
IG_like 325..410 CDD:214653 25/87 (29%)
Dscam4NP_001261571.1 Ig 31..118 CDD:299845
IG 135..209 CDD:214652
IG_like 246..326 CDD:214653
Ig 254..323 CDD:143165
I-set 335..416 CDD:254352 2/4 (50%)
Ig 336..417 CDD:299845 2/5 (40%)
IG_like 429..516 CDD:214653 22/105 (21%)
Ig 439..513 CDD:143165 19/92 (21%)
IG_like 526..607 CDD:214653 26/92 (28%)
IGc2 532..594 CDD:197706 25/73 (34%)
IG 624..703 CDD:214652 25/86 (29%)
Ig 631..699 CDD:143165 22/75 (29%)
I-set 707..801 CDD:254352 16/96 (17%)
Ig 724..801 CDD:299845 13/79 (16%)
I-set 806..902 CDD:254352 18/75 (24%)
Ig 819..909 CDD:299845 14/62 (23%)
FN3 906..999 CDD:238020
FN3 1006..1110 CDD:238020
fn3 1117..1203 CDD:278470
FN3 1215..1307 CDD:238020
Ig 1313..1394 CDD:299845
FN3 1405..1494 CDD:238020
FN3 1499..1580 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.