DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and dpr7

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster

Alignment Length:250 Identity:67/250 (27%)
Similarity:97/250 (39%) Gaps:56/250 (22%)


  Fly   105 NLNIVVEEPEFTEYIE-----NVTVP-----AGRNVK--------LGCSVKNLGSYKVAWMHFEQ 151
            ||||..:....|.|:.     |:..|     :.|||.        |.|.|||.|:..|:||....
  Fly    26 NLNIWCQYISATSYLSLNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRD 90

  Fly   152 SAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVV 216
            ..|||.:.:..|.:.|.||.|....  ..|.|.|:.....|.|.|.||:||.........|.|:.
  Fly    91 LHILTTNIYTYTGDQRFSVIHPPGS--EDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIA 153

  Fly   217 PPNIDD----------------SLSSSDVIVREGANISLRCRASGSPRPIIKWKRD------DNS 259
            ..:..|                .|.|:::.|:..:.|:|.|..: ...|.:.|...      |:.
  Fly   154 DNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTIALACSVN-IHAPSVIWYHGSSVVDFDSL 217

  Fly   260 RIAIN----KNHIVNEWEGDT--LEITRISRLDMGAYLCIASNGVPPTVSKRIKV 308
            |..|:    |..:     |.|  |.:||.|..|.|.|.|:.:..:|.:|  |:.|
  Fly   218 RGGISLETEKTDV-----GTTSRLMLTRASLRDSGNYTCVPNGAIPASV--RVHV 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 34/114 (30%)
Ig 130..200 CDD:143165 26/78 (33%)
I-set 226..310 CDD:254352 25/95 (26%)
IGc2 233..298 CDD:197706 19/77 (25%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
dpr7NP_001096850.2 V-set 56..145 CDD:284989 30/91 (33%)
IG_like 58..140 CDD:214653 30/84 (36%)
IG_like 179..265 CDD:214653 24/94 (26%)
Ig 187..257 CDD:299845 19/76 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.