DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and dpr1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001286645.1 Gene:dpr1 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster

Alignment Length:267 Identity:67/268 (25%)
Similarity:103/268 (38%) Gaps:52/268 (19%)


  Fly    99 ANVPTSNLNIVVEEPEFTEYIE-----NVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVH 158
            |..|.:.....:.......|.:     |:||..|:...|.|.|:.||...|:|:......|||..
  Fly    35 APTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAG 99

  Fly   159 NHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDS 223
            ....|.:.|..|.  :.|....|.|.|......|.|.|.||||| ..|....|...||.... :.
  Fly   100 GTTYTSDQRFQVL--RPDGSANWTLQIKYPQPRDSGVYECQINT-EPKMSLSYTFNVVELKA-EI 160

  Fly   224 LSSSDVIVREGANISLRCRASGSPRPI--IKW---------KRDDNSRIAINKNHIVNEW-EGDT 276
            ...||::|:.|::|:|.|:....|..:  |.|         |.::....::.:..:.::| :|.|
  Fly   161 FGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLT 225

  Fly   277 --LEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEA 339
              |:|.|....|.|.|.|:      |||:|...|.|         |.::|              .
  Fly   226 SRLKIKRAMPGDTGNYTCV------PTVAKTSSVYV---------HVIIG--------------E 261

  Fly   340 HPTSLNY 346
            ||.::.:
  Fly   262 HPAAMQH 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 32/101 (32%)
Ig 130..200 CDD:143165 22/70 (31%)
I-set 226..310 CDD:254352 26/98 (27%)
IGc2 233..298 CDD:197706 18/79 (23%)
Ig 313..410 CDD:299845 4/35 (11%)
IG_like 325..410 CDD:214653 2/23 (9%)
dpr1NP_001286645.1 Ig 59..154 CDD:299845 32/98 (33%)
IG_like 60..150 CDD:214653 31/93 (33%)
IG_like 163..257 CDD:214653 28/109 (26%)
Ig 174..244 CDD:143165 17/70 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.