DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and dpr9

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:377 Identity:98/377 - (25%)
Similarity:145/377 - (38%) Gaps:108/377 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLVLAATAGD---------------STNKIILPQILNGGGGGGGVGTAQGKHPSGSKTVATGVVP 61
            ::|:|..:|:               |::...||   |.|.||...|..:...|.     .||:  
  Fly   114 VVVMALMSGNGVYAAQRDSYNSKDMSSSNNALP---NEGVGGSAAGAGEAAAPG-----PTGI-- 168

  Fly    62 NFGGAAGNGAGG----GGPVAGSGTGS-----TVVGSNGVIVAGGGA----NVPTSNL------- 106
             .|..:||.:.|    |.|.||||..|     |...|...:   |||    .:|:|:|       
  Fly   169 -DGSGSGNNSSGNNKNGHPAAGSGAASESAALTTDASRSSV---GGATTITGIPSSSLHKASSAS 229

  Fly   107 ---------------NIVVEE-----PEFTE-YIENVTVPAGRNVKLGCSVKNLGS----YKVAW 146
                           :|.:||     |.|.: :.:|||...|:...|.|.|||||:    .:|:|
  Fly   230 SNTFSSQLASGFHRNSIDLEEARNAGPYFDKAFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSW 294

  Fly   147 MHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGY 211
            :......:|||..:..|.:.|....|  ..:...|.|.|......|.|.|.||::|....:.:.:
  Fly   295 VRHRDIHLLTVGRYTYTSDQRFRAIH--QPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMSHYIH 357

  Fly   212 LNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRP--IIKWKRD------------DNSR-- 260
            ||||.|..  :.:.:.|:.:..|:.|:|.|....||.|  .|.|..:            |:.|  
  Fly   358 LNVVEPST--EIIGAPDLYIESGSTINLTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPRGG 420

  Fly   261 --IAINKNHIVNEWEGDT----LEITRISRLDMGAYLCIASNGVPPTVSKRI 306
              :..||        |||    |.|......|.|.|.|..||..|.:|:..:
  Fly   421 VSVVTNK--------GDTTTSFLLIKSARPSDSGHYQCNPSNAKPKSVTVHV 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 31/99 (31%)
Ig 130..200 CDD:143165 22/73 (30%)
I-set 226..310 CDD:254352 27/103 (26%)
IGc2 233..298 CDD:197706 24/86 (28%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
dpr9NP_001287332.1 Ig 263..361 CDD:299845 30/99 (30%)
IG_like 263..360 CDD:214653 29/98 (30%)
IG_like 371..464 CDD:214653 27/100 (27%)
IGc2 377..456 CDD:197706 24/86 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.