DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Cntn6

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_037357.1 Gene:Cntn6 RGDID:62008 Length:1028 Species:Rattus norvegicus

Alignment Length:485 Identity:103/486 (21%)
Similarity:163/486 (34%) Gaps:153/486 (31%)


  Fly   108 IVVEEPEFTEYIENVTVP---AGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRIS 169
            |.::||      ::|..|   :...:.|.|:.....|....|.........::..|.......::
  Rat    27 IFIQEP------QDVIFPLDLSRSEIILSCTASGYPSPHYRWKQNGTDIDFSMTYHYRLDGGSLA 85

  Fly   170 VTHDKHDRHRTWYLHINNVHEEDRGRYMC----QINTV---TAKTQFGYLNVVVPPNIDD--SLS 225
            ::..:.|              :|.|.|.|    .:.|:   .||.||.|        |:|  :.|
  Rat    86 ISSPRTD--------------QDIGIYQCLATNPVGTILSRKAKLQFAY--------IEDFETKS 128

  Fly   226 SSDVIVREGANISLRCRASGSPRP-----IIKWKRDDNS-RIAINKNHIVNEWEGDTLEITRISR 284
            .|.|.||||..:.|.|    .|.|     ...|..:||. .:..:|...|::..|: |.|.::..
  Rat   129 RSTVSVREGQGVVLLC----GPPPHFGELSYDWTFNDNPLYVQEDKRRFVSQNTGN-LYIAKVEP 188

  Fly   285 LDMGAYLCIASN--------GVPPTVSKRI---------KVSVDFPPMLLIPHQLVGAPEGFNVT 332
            .|:|.|.|..:|        |.|..:.:|.         |:.|.||       :.:.|.:..:|.
  Rat   189 SDVGNYTCFVTNKEAHRSVQGPPTPLVQRTDGVMGEYEPKIEVRFP-------ETIQAAKDSSVK 246

  Fly   333 IECFTEAHPTSLNYWTRGEGPIIHDSHKY-KVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAK 396
            :|||...:|.....|.|.:|..:....|| ..:||:.:|.::..           |:|.|:|||.
  Rat   247 LECFALGNPVPDISWRRLDGSPMPGKVKYSNSQATLEIPKFQQE-----------DEGFYECVAG 300

  Fly   397 NPRGETDGIIRLYVSYPPTTASSGIYSTDTHWGENGINNNY------------AYGGPD------ 443
            |.||......:|....||            .| |..|.|.|            |.|.|:      
  Rat   301 NLRGRNLAKGQLIFYAPP------------EW-EQKIQNTYLSIYDSLFWECKASGNPNPSYTWL 352

  Fly   444 --------------------------STRSIYAQDKNTRYQSNLNEIGLSEQKSFLDKTQNPL-- 480
                                      |...||......:||:......|....|..|.::||:  
  Rat   353 KNGERLNTEERIQTENGTLIITMLNVSDSGIYQCAAENKYQTIYANAELRVLASAPDFSKNPIKK 417

  Fly   481 ---LANGNANEADAESNGARGHNPSMAIAW 507
               :..|.....:.:.|..    |..:|:|
  Rat   418 ISVVQVGGDISIECKPNAF----PKASISW 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 18/106 (17%)
Ig 130..200 CDD:143165 10/74 (14%)
I-set 226..310 CDD:254352 27/107 (25%)
IGc2 233..298 CDD:197706 20/79 (25%)
Ig 313..410 CDD:299845 25/98 (26%)
IG_like 325..410 CDD:214653 24/86 (28%)
Cntn6NP_037357.1 Ig 26..114 CDD:299845 16/107 (15%)
Ig 120..214 CDD:299845 29/107 (27%)
Ig 227..315 CDD:299845 28/106 (26%)
I-set 227..313 CDD:254352 28/104 (27%)
I-set 318..403 CDD:254352 15/98 (15%)
Ig 319..403 CDD:299845 14/85 (16%)
I-set 408..496 CDD:254352 8/41 (20%)
Ig5_Contactin_like 424..496 CDD:143170 5/25 (20%)
I-set 501..594 CDD:254352
Ig 515..598 CDD:299845
FN3 598..691 CDD:238020
FN3 703..796 CDD:238020
fn3 805..891 CDD:278470
FN3 903..983 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.