DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and Cntn4

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001103219.1 Gene:Cntn4 / 269784 MGIID:1095737 Length:1026 Species:Mus musculus


Alignment Length:397 Identity:105/397 - (26%)
Similarity:150/397 - (37%) Gaps:80/397 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KHPSGSKT-VATGVVPNFGGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVV 110
            |...|:.| |.|..|.|.            .|.|..| ..::.::||:    |...|    .|.|
Mouse   186 KSDVGNYTCVVTNTVTNH------------KVLGPPT-PLILRNDGVM----GEYEP----KIEV 229

  Fly   111 EEPEFTEYIENVTVPA--GRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHD 173
            :.||        ||||  |..|||.|.........:.|...:        ...|.|..|      
Mouse   230 QFPE--------TVPAEKGTTVKLECFALGNPVPTILWRRAD--------GKPIARKAR------ 272

  Fly   174 KHDRHRT-WYLHINNVHEEDRGRYMCQINTVTAK-TQFGYLNVVVPPNIDDSLSSSDVIVREGAN 236
               ||:: ..|.|.|..:||.|.|.|.......| ...|.|.....||....::...|.:.|  :
Mouse   273 ---RHKSNGILEIPNFQQEDAGSYECVAENSRGKNVAKGQLTFYAQPNWVQIINDIHVAMEE--S 332

  Fly   237 ISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASN--GVP 299
            :...|:|:|.|:|..:|.::.:..:..::..|    |..||.||.::..|.|.|.|:|.|  || 
Mouse   333 VFWECKANGRPKPTYRWLKNGDPLLTRDRIQI----EQGTLNITIVNLSDAGMYQCVAENKHGV- 392

  Fly   300 PTVSKRIKVSV-----DFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSH 359
              :....::||     ||...||....||..  |..|.|||..:|.|..:..|.:|. .|:.::.
Mouse   393 --IFSSAELSVIAESPDFSRTLLKRVTLVKV--GGEVVIECKPKASPRPVYTWRKGR-EILRENE 452

  Fly   360 KYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYST 424
            :..:         .....|.||||:..|.|.|.|:|.|..|.......:.|. .||.......|.
Mouse   453 RITI---------SEDGNLRIINVTKSDAGSYTCIATNHFGTASSTGNVIVK-DPTKVMVPPSSM 507

  Fly   425 DTHWGEN 431
            |...||:
Mouse   508 DVTVGES 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 26/99 (26%)
Ig strand B 130..134 CDD:409405 3/3 (100%)
Ig strand C 143..147 CDD:409405 0/3 (0%)
Ig strand E 178..185 CDD:409405 2/7 (29%)
IgI_1_MuSK 218..310 CDD:409562 24/93 (26%)
Ig strand A 218..221 CDD:409562 2/2 (100%)
Ig strand A' 226..231 CDD:409562 1/4 (25%)
Ig strand B 237..244 CDD:409562 1/6 (17%)
Ig strand C 250..255 CDD:409562 1/4 (25%)
Ig strand C' 257..259 CDD:409562 0/1 (0%)
Ig strand D 267..270 CDD:409562 1/2 (50%)
Ig strand E 275..281 CDD:409562 3/5 (60%)
Ig strand F 288..295 CDD:409562 3/6 (50%)
Ig strand G 302..310 CDD:409562 0/7 (0%)
IG_like 325..410 CDD:214653 22/84 (26%)
Ig strand B 331..335 CDD:143207 2/3 (67%)
Ig strand C 344..348 CDD:143207 0/3 (0%)
Ig strand E 376..380 CDD:143207 1/3 (33%)
Ig strand F 390..395 CDD:143207 2/4 (50%)
Ig strand G 403..406 CDD:143207 0/2 (0%)
Cntn4NP_001103219.1 Ig 25..120 CDD:472250
Ig strand B 46..50 CDD:409353
Ig strand C 59..63 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 97..102 CDD:409353
Ig strand G 111..114 CDD:409353
Ig 129..213 CDD:472250 10/39 (26%)
Ig strand B 140..144 CDD:409353
Ig strand C 154..158 CDD:409353
Ig strand E 177..181 CDD:409353
Ig strand F 191..196 CDD:409353 1/4 (25%)
Ig strand G 207..210 CDD:409353 1/2 (50%)
Ig 225..313 CDD:472250 31/116 (27%)
Ig strand B 243..247 CDD:409353 3/3 (100%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 1/3 (33%)
Ig strand F 292..297 CDD:409353 2/4 (50%)
Ig strand G 305..308 CDD:409353 0/2 (0%)
Ig 318..401 CDD:472250 22/91 (24%)
Ig strand B 333..337 CDD:409353 0/3 (0%)
Ig strand C 346..350 CDD:409353 0/3 (0%)
Ig strand E 367..371 CDD:409353 2/3 (67%)
Ig strand F 381..386 CDD:409353 2/4 (50%)
Ig strand G 394..397 CDD:409353 0/2 (0%)
Ig 406..494 CDD:472250 28/99 (28%)
Ig strand B 425..429 CDD:409353 2/3 (67%)
Ig strand C 438..442 CDD:409353 0/3 (0%)
Ig strand E 460..464 CDD:409353 1/3 (33%)
Ig strand F 474..479 CDD:409353 2/4 (50%)
Ig strand G 487..490 CDD:409353 0/2 (0%)
Ig6_Contactin-4 496..597 CDD:409439 6/19 (32%)
Ig strand A 496..502 CDD:409439 2/5 (40%)
Ig strand A' 505..510 CDD:409439 2/4 (50%)
Ig strand B 513..521 CDD:409439 1/2 (50%)
Ig strand C 530..534 CDD:409439
Ig strand D 555..558 CDD:409439
Ig strand E 559..563 CDD:409439
Ig strand F 572..579 CDD:409439
FN3 580..>1014 CDD:442628
Ig strand G 586..590 CDD:409439
FN3 597..690 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..710
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 886..906
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.