DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Cntn4

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001103219.1 Gene:Cntn4 MGIID:1095737 Length:1026 Species:Mus musculus

Alignment Length:397 Identity:105/398 (26%)
Similarity:150/398 (38%) Gaps:80/398 (20%)


  Fly    47 KHPSGSKT-VATGVVPNFGGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVV 110
            |...|:.| |.|..|.|.            .|.|..| ..::.::||:    |...|    .|.|
Mouse   186 KSDVGNYTCVVTNTVTNH------------KVLGPPT-PLILRNDGVM----GEYEP----KIEV 229

  Fly   111 EEPEFTEYIENVTVPA--GRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHD 173
            :.||        ||||  |..|||.|.........:.|...:        ...|.|..|      
Mouse   230 QFPE--------TVPAEKGTTVKLECFALGNPVPTILWRRAD--------GKPIARKAR------ 272

  Fly   174 KHDRHRT-WYLHINNVHEEDRGRYMCQINTVTAK-TQFGYLNVVVPPNIDDSLSSSDVIVREGAN 236
               ||:: ..|.|.|..:||.|.|.|.......| ...|.|.....||....::...|.:.|  :
Mouse   273 ---RHKSNGILEIPNFQQEDAGSYECVAENSRGKNVAKGQLTFYAQPNWVQIINDIHVAMEE--S 332

  Fly   237 ISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASN--GVP 299
            :...|:|:|.|:|..:|.::.:..:..::..|    |..||.||.::..|.|.|.|:|.|  || 
Mouse   333 VFWECKANGRPKPTYRWLKNGDPLLTRDRIQI----EQGTLNITIVNLSDAGMYQCVAENKHGV- 392

  Fly   300 PTVSKRIKVSV-----DFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSH 359
              :....::||     ||...||....||..  |..|.|||..:|.|..:..|.:|. .|:.::.
Mouse   393 --IFSSAELSVIAESPDFSRTLLKRVTLVKV--GGEVVIECKPKASPRPVYTWRKGR-EILRENE 452

  Fly   360 KYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYST 424
            :..:         .....|.||||:..|.|.|.|:|.|..|.......:.|. .||.......|.
Mouse   453 RITI---------SEDGNLRIINVTKSDAGSYTCIATNHFGTASSTGNVIVK-DPTKVMVPPSSM 507

  Fly   425 DTHWGEN 431
            |...||:
Mouse   508 DVTVGES 514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 26/100 (26%)
Ig 130..200 CDD:143165 18/71 (25%)
I-set 226..310 CDD:254352 23/86 (27%)
IGc2 233..298 CDD:197706 20/67 (30%)
Ig 313..410 CDD:299845 26/97 (27%)
IG_like 325..410 CDD:214653 22/85 (26%)
Cntn4NP_001103219.1 Ig 25..118 CDD:325142
Ig 120..213 CDD:325142 10/40 (25%)
Ig 225..313 CDD:325142 31/117 (26%)
Ig 318..401 CDD:325142 23/92 (25%)
Ig 422..494 CDD:325142 22/82 (27%)
Ig6_Contactin-4 513..597 CDD:143261 1/3 (33%)
FN3 597..690 CDD:238020
FN3 703..792 CDD:238020
FN3 804..896 CDD:238020
FN3 904..989 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.