DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Lsamp

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001348211.1 Gene:Lsamp MGIID:1261760 Length:378 Species:Mus musculus

Alignment Length:364 Identity:111/365 (30%)
Similarity:165/365 (45%) Gaps:52/365 (14%)


  Fly   100 NVPTSNLN--------IVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILT 156
            |.|.:.:|        :.|...:|....:|:||..|....|.|.|::..| ||||::  :|.|:.
Mouse    28 NQPPAEVNLSPITIPGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNS-KVAWLN--RSGIIF 89

  Fly   157 VHNHVITRNPRISVTHDKHDRHRTWY-LHINNVHEEDRGRYMCQINTV-TAKTQFGYLNVVVPPN 219
            ..:...:.:||:.:    ..||...| |.|..|...|.|.|.|.:.|. ..||...||.|.|||.
Mouse    90 AGHDKWSLDPRVEL----EKRHALEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPK 150

  Fly   220 IDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIV---NEWEGDT--LEI 279
            |  |..||||.|.||:|::|.|.|:|.|.|:|.|:            |:.   .|:||:.  |||
Mouse   151 I--SNISSDVTVNEGSNVTLVCMANGRPEPVITWR------------HLTPLGREFEGEEEYLEI 201

  Fly   280 TRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSL 344
            ..|:|...|.|.|.|:|.|.....|::||:|::|| .:...:...|..|...:::|...|.|...
Mouse   202 LGITREQSGKYECKAANEVSSADVKQVKVTVNYPP-TITESKSNEATTGRQASLKCEASAVPAPD 265

  Fly   345 NYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLY 409
            ..|.| :...|:.::..::::|.|      ...||:.||:....|.|.|||.|..|.|:..:.|:
Mouse   266 FEWYR-DDTRINSANGLEIKSTEG------QSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLF 323

  Fly   410 VSYPPTTASSGIYSTDTHWGENGINNNYAYGGPDSTRSI 448
            ....||....        ..|.|...::...||.|.|.|
Mouse   324 KRVLPTVPHP--------IQEIGTTVHFKPKGPGSVRGI 354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 32/98 (33%)
Ig 130..200 CDD:143165 22/71 (31%)
I-set 226..310 CDD:254352 34/89 (38%)
IGc2 233..298 CDD:197706 25/70 (36%)
Ig 313..410 CDD:299845 25/97 (26%)
IG_like 325..410 CDD:214653 23/85 (27%)
LsampNP_001348211.1 Ig 55..145 CDD:325142 31/97 (32%)
Ig_3 148..218 CDD:316449 33/84 (39%)
Ig_3 235..311 CDD:316449 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80608729
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4562
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 1 1.000 T130864
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.