DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and LRIT1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_056428.1 Gene:LRIT1 HGNCID:23404 Length:623 Species:Homo sapiens

Alignment Length:300 Identity:63/300 (21%)
Similarity:92/300 (31%) Gaps:123/300 (41%)


  Fly   234 GANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGV 298
            |....|||.|:|.|.|.:.|:|                                       :||.
Human   268 GGTALLRCGATGVPGPEMSWRR---------------------------------------ANGR 293

  Fly   299 PPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKV 363
            |                             .|.|:.....:..||   ||               
Human   294 P-----------------------------LNGTVHQEVSSDGTS---WT--------------- 311

  Fly   364 EATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPT-TASSGIYSTDTH 427
              .:||||           ||..|.|.|.|.|||..|.::.:|.|.|:.||| |..||  |....
Human   312 --LLGLPA-----------VSHLDSGDYICQAKNFLGASETVISLIVTEPPTSTEHSG--SPGAL 361

  Fly   428 WGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNLNEIGLSEQKSFLDKTQNPLLANGNANEADAE 492
            |...|       ||.::  :.|......|:...:.:..:......:..|:..|.......:|..|
Human   362 WARTG-------GGGEA--AAYNNKLVARHVPQIPKPAVLATGPSVPSTKEELTLEHFQMDALGE 417

  Fly   493 -SNGARGHNPSMAIAWLFVVIATLLLTIRSAVGSSHSLSL 531
             |:|..|  ||.         |.::.:::....:.||:||
Human   418 LSDGRAG--PSE---------ARMVRSVKVVGDTYHSVSL 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653
Ig 130..200 CDD:143165
I-set 226..310 CDD:254352 13/76 (17%)
IGc2 233..298 CDD:197706 12/64 (19%)
Ig 313..410 CDD:299845 22/97 (23%)
IG_like 325..410 CDD:214653 22/85 (26%)
LRIT1NP_056428.1 LRR 1 60..81
leucine-rich repeat 61..84 CDD:275378
LRR_8 63..143 CDD:290566
LRR 2 84..105
leucine-rich repeat 85..132 CDD:275378
LRR 3 108..129
LRR_8 131..202 CDD:290566
LRR_4 131..171 CDD:289563
LRR 4 132..153
leucine-rich repeat 133..156 CDD:275378
LRR 5 156..177
leucine-rich repeat 157..180 CDD:275378
leucine-rich repeat 181..205 CDD:275378
TPKR_C2 201..>240 CDD:301599
Ig 267..345 CDD:299845 35/176 (20%)
IG_like 267..345 CDD:214653 35/176 (20%)
FN3 431..498 CDD:214495 4/16 (25%)
LRR 6. {ECO:0000305} 571..594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.