DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and DIP-lambda

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001334747.1 Gene:DIP-lambda FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster

Alignment Length:431 Identity:154/432 (36%)
Similarity:220/432 (51%) Gaps:47/432 (11%)


  Fly   112 EPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHD 176
            :|:|...:.|.|||.||::...|.|.|||.|:|||:..:..|||.:|.|:::.|||:||||:.|:
  Fly    49 DPQFLAKLSNTTVPIGRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHN 113

  Fly   177 RHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNI--DDSLSSSDVIVREGANISL 239
               ||.|||:.|...|.|.||||:||...|:..|||:|||||:|  ....:..|.:.:||.:|||
  Fly   114 ---TWKLHISRVQINDSGSYMCQVNTDPMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISL 175

  Fly   240 RCRASGSPRPIIKWKRDDNSRIAINKNHI----VNEWEGDTLEITRISRLDMGAYLCIASNGVPP 300
            .|..:|.|||.:.|:|:....|.:..:..    ....||:.|.:|.:.|.|||.|.||||||:||
  Fly   176 MCSVTGVPRPKVLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPP 240

  Fly   301 TVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPI-IHDSHKYKVE 364
            :||||..|.|:|.|.:....||||||....||:||..|..|..||.|.|.||.| :|:.:||.:.
  Fly   241 SVSKRFNVYVNFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLNGWYRSEGNIKLHNGNKYNIS 305

  Fly   365 ATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLY-VSYPP-----------TTA 417
            ..| :..|..|:.|||.:::..|.|.|.|.:.|..|:::.:|||. :..||           ||.
  Fly   306 EEV-INIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLPPKLTTTPTPHMQTTG 369

  Fly   418 SSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNLNEIGLSEQKSFLDKTQNPLLA 482
            .|......:|  :.|:|....:........|  |.:|..:    || |....|....:..|.:|.
  Fly   370 KSRRKHPASH--KKGLNEVLRFQETHFANQI--QQENEDH----NE-GFDLLKFTNSENSNIVLE 425

  Fly   483 NGNANE---------------ADAESNGARGHNPSMAIAWL 508
            :|:.|.               ...::|...|..||....|:
  Fly   426 SGHINSMINKEDVNIYHPKQYGQEKTNKPSGTIPSTRTPWI 466

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 48/96 (50%)
Ig 130..200 CDD:143165 34/70 (49%)
I-set 226..310 CDD:254352 36/88 (41%)
IGc2 233..298 CDD:197706 28/69 (41%)
Ig 313..410 CDD:299845 38/99 (38%)
IG_like 325..410 CDD:214653 33/87 (38%)
DIP-lambdaNP_001334747.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4553
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12231
RoundUp 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.