DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and NEGR1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 HGNCID:17302 Length:354 Species:Homo sapiens

Alignment Length:305 Identity:95/306 (31%)
Similarity:144/306 (47%) Gaps:29/306 (9%)


  Fly   119 IENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISV-THDKHDRHRTWY 182
            ::|:.|..|....|.|.::: |:.|.||::  :|:|:.......:.:||:|: |.:|.|    :.
Human    45 VDNMMVRKGDTAVLRCYLED-GASKGAWLN--RSSIIFAGGDKWSVDPRVSISTLNKRD----YS 102

  Fly   183 LHINNVHEEDRGRYMCQINTV-TAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGS 246
            |.|.||...|.|.|.|.:.|. |.:|...:|.|.|||.|.|  .|:|:.|.||.|::|.|.|:|.
Human   103 LQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYD--ISNDMTVNEGTNVTLTCLATGK 165

  Fly   247 PRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVD 311
            |.|.|.|:     .|:.:.....|   |..|:|..|:|...|.|.|.|.|.|.....:::||.|:
Human   166 PEPSISWR-----HISPSAKPFEN---GQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVN 222

  Fly   312 FPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHM 376
            |.|.:.........| |.:..|.|.....|.....|.:||..:      :..:..:.:..:.|..
Human   223 FAPTIQEIKSGTVTP-GRSGLIRCEGAGVPPPAFEWYKGEKKL------FNGQQGIIIQNFSTRS 280

  Fly   377 KLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGI 421
            .||:.||:....|.|.|||.|..|.|:..:.|   .||:||..||
Human   281 ILTVTNVTQEHFGNYTCVAANKLGTTNASLPL---NPPSTAQYGI 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/98 (31%)
Ig 130..200 CDD:143165 22/71 (31%)
I-set 226..310 CDD:254352 29/84 (35%)
IGc2 233..298 CDD:197706 23/65 (35%)
Ig 313..410 CDD:299845 23/97 (24%)
IG_like 325..410 CDD:214653 22/85 (26%)
NEGR1NP_776169.2 Ig 44..135 CDD:299845 29/97 (30%)
IG_like 47..135 CDD:214653 29/95 (31%)
IGc2 152..210 CDD:197706 24/66 (36%)
IG_like 231..312 CDD:214653 21/88 (24%)
Ig 243..309 CDD:143165 19/72 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80620772
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 1 1.000 T130085
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6406
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.