DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Lrit1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_647547.2 Gene:Lrit1 RGDID:628607 Length:623 Species:Rattus norvegicus

Alignment Length:267 Identity:61/268 (23%)
Similarity:91/268 (34%) Gaps:73/268 (27%)


  Fly   113 PEFTEYIENVT-VPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITR-------NPRIS 169
            ||...::||:| :....|..:....:.|.:    |.|.:....|:...   ||       ||.:.
  Rat   148 PEAVHFLENLTFLDLSNNQLMRLPEELLDT----WAHLKTGPYLSSRR---TRLVLGLQDNPWVC 205

  Fly   170 VTHDKHDRHRTWYLHI------NNVHEEDRGRYMCQINTVTAKTQFGYLNV--VVPPNIDDSLSS 226
                  |......:|:      |.:..|.|.|  |......|...|..|.:  ...|.:...::|
  Rat   206 ------DCRLYDLVHLLDGWASNLIFIEARLR--CGSPRSLAGVAFSQLELRKCQSPELRPGVTS 262

  Fly   227 SDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDT---LEITRISRLDMG 288
              :|...|:.:.|||.|:|.|.|.:.|:| .|.|......|.....:|.:   |::..:|..|.|
  Rat   263 --IISPLGSTVLLRCGATGIPGPEMSWRR-ANGRPLNGTVHQEVSSDGSSWTLLDLPVVSLFDSG 324

  Fly   289 AYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNY------- 346
            .|:|.|.|                         .:||.|   ..|........||..|       
  Rat   325 DYICQAKN-------------------------FLGASE---TLISLIVTEPQTSTEYTGIPGAL 361

  Fly   347 WTR-GEG 352
            |.| |||
  Rat   362 WARTGEG 368

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/112 (20%)
Ig 130..200 CDD:143165 15/83 (18%)
I-set 226..310 CDD:254352 24/87 (28%)
IGc2 233..298 CDD:197706 22/68 (32%)
Ig 313..410 CDD:299845 12/49 (24%)
IG_like 325..410 CDD:214653 11/37 (30%)
Lrit1NP_647547.2 LRRNT 23..61 CDD:214470
LRR 1 60..81
LRR_8 63..143 CDD:290566
leucine-rich repeat 64..84 CDD:275378
LRR 2 84..105
leucine-rich repeat 85..132 CDD:275378
LRR 3 108..128
LRR_8 131..>176 CDD:290566 7/28 (25%)
LRR_4 131..172 CDD:289563 6/24 (25%)
LRR 4 132..153 2/5 (40%)
leucine-rich repeat 133..156 CDD:275378 3/8 (38%)
LRR 5 156..177 4/21 (19%)
leucine-rich repeat 157..180 CDD:275378 4/27 (15%)
leucine-rich repeat 181..205 CDD:275378 5/27 (19%)
TPKR_C2 201..>240 CDD:301599 10/47 (21%)
Ig 257..345 CDD:299845 28/119 (24%)
IG_like 267..345 CDD:214653 26/107 (24%)
FN3 431..501 CDD:214495
LRR 6 525..548
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.