DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Ncam1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_008764414.1 Gene:Ncam1 RGDID:67378 Length:1136 Species:Rattus norvegicus

Alignment Length:423 Identity:100/424 (24%)
Similarity:161/424 (38%) Gaps:90/424 (21%)


  Fly   100 NVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAIL--TVHNHVI 162
            |.||..        ||.|         |.:..:.|.|.:.....:.|.|..:..||  .|...|:
  Rat   122 NAPTPQ--------EFKE---------GEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVL 169

  Fly   163 TRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSS 227
            :.|                ||.|..:.:.|.|.|.|: ..:.|:.:..:.::.|..|:..::.:.
  Rat   170 SNN----------------YLQIRGIKKTDEGTYRCE-GRILARGEINFKDIQVIVNVPPTVQAR 217

  Fly   228 DVIVREGAN----ISLRCRASGSPRPIIKWKRD----DNSRIAINKNHIVNEWEGDTLEITRISR 284
            ..||...||    ::|.|.|.|.|.|.:.|.:|    :|.. ..::.||.:: :...|.|..:.:
  Rat   218 QSIVNATANLGQSVTLVCDADGFPEPTMSWTKDGEPIENEE-EDDEKHIFSD-DSSELTIRNVDK 280

  Fly   285 LDMGAYLCIASNGV-PPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHP-TSLNY- 346
            .|...|:|||.|.. ....|..:||... |.:..:.:|.....|. .||:.|.....| .|:.: 
  Rat   281 NDEAEYVCIAENKAGEQDASIHLKVFAK-PKITYVENQTAMELEE-QVTLTCEASGDPIPSITWR 343

  Fly   347 -------------WTRGEGPIIHDSHKYKVEATVGLPAYKTHMK---LTIINVSSGDDGIYKCVA 395
                         |||.|          |.|...|....::|.:   ||:.::...|.|.|.|.|
  Rat   344 TSTRNISSEEKASWTRPE----------KQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTA 398

  Fly   396 KNPRGETDGIIRLYVSYPPTTASS-GIYSTDTHWGENGIN---NNYAYGGPDSTRSIYAQDKNTR 456
            .|..|:....:.|.|.|.|..... .:|:    |..|.:|   ..:||  |.:|.| :.:|....
  Rat   399 SNTIGQDSQSMYLEVQYAPKLQGPVAVYT----WEGNQVNITCEVFAY--PSATIS-WFRDGQLL 456

  Fly   457 YQSNLNEIGL--SEQKSFLDKTQNPLLANGNAN 487
            ..||.:.|.:  :...|:|:.|.:.....||.|
  Rat   457 PSSNYSNIKIYNTPSASYLEVTPDSENDFGNYN 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 18/98 (18%)
Ig 130..200 CDD:143165 16/72 (22%)
I-set 226..310 CDD:254352 26/93 (28%)
IGc2 233..298 CDD:197706 21/73 (29%)
Ig 313..410 CDD:299845 26/115 (23%)
IG_like 325..410 CDD:214653 24/103 (23%)
Ncam1XP_008764414.1 Ig1_NCAM-1 20..115 CDD:143273
I-set 21..114 CDD:254352
IG_like 124..190 CDD:214653 22/99 (22%)
IGc2 131..192 CDD:197706 18/87 (21%)
Ig3_NCAM-1_like 211..308 CDD:143207 26/99 (26%)
I-set 218..305 CDD:254352 25/89 (28%)
Ig5_NCAM-1 307..413 CDD:143277 26/118 (22%)
I-set 309..413 CDD:254352 26/115 (23%)
IG_like 422..500 CDD:214653 19/76 (25%)
IGc2 429..497 CDD:197706 17/65 (26%)
FN3 509..606 CDD:238020
fn3 619..701 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.