DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Kirrel2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_766486.1 Gene:Kirrel2 MGIID:2442334 Length:700 Species:Mus musculus

Alignment Length:337 Identity:80/338 (24%)
Similarity:129/338 (38%) Gaps:72/338 (21%)


  Fly   113 PEFTEYIENVTVPAGRNVKLGCSVKNLGSYK--VAWMHFEQSAILTVHNHVITRNP-RISVTHDK 174
            |.|.:..|::.|..|...:|.|:   ||:|:  |.|                |::. .:....|.
Mouse    21 PHFLQQPEDMVVLLGEEARLPCA---LGAYRGLVQW----------------TKDGLALGGERDL 66

  Fly   175 HDRHRTWY----------LHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDV 229
            ....|.|.          |||..|..||...|.||.:....:::...|:|:|||.....|....|
Mouse    67 PGWSRYWISGNSASGQHDLHIKPVELEDEASYECQASQAGLRSRPAQLHVMVPPEAPQVLGGPSV 131

  Fly   230 IVREGANISLRCRASGS--PRPIIKWKRD----DNSRIAINKNHIVNEWEG---DTLEITRISRL 285
            .:..|...:|.||:.|.  |.|.:.|.||    |.|  :.::..:.::..|   :||.:|..|..
Mouse   132 SLVAGVPGNLTCRSRGDSRPAPELLWFRDGIRLDGS--SFHQTTLKDKATGTVENTLFLTPSSHD 194

  Fly   286 DMGAYLCIA-SNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNY-WT 348
            |....:|.| |..:|......:.:|:.:|||:.:..:.....||..||..|...|.|....| |.
Mouse   195 DGATLICRARSQALPTGRDTAVTLSLQYPPMVTLSAEPQTVQEGEKVTFLCQATAQPPVTGYRWA 259

  Fly   349 RGEGPI----------------IHDSHKYKVEATVGLPAYKTHMKLTI----------INVSSGD 387
            :|..|:                :.:....:|...||.....|.:::..          ::|..|.
Mouse   260 KGGSPVLGARGPRLEVVADATFLTEPVSCEVSNAVGSANRSTALEVLYGPILQAKPKSVSVDVGK 324

  Fly   388 DGIYKCVAK-NP 398
            |..:.||.: ||
Mouse   325 DASFSCVWRGNP 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 25/109 (23%)
Ig 130..200 CDD:143165 20/83 (24%)
I-set 226..310 CDD:254352 24/94 (26%)
IGc2 233..298 CDD:197706 21/75 (28%)
Ig 313..410 CDD:299845 25/115 (22%)
IG_like 325..410 CDD:214653 22/103 (21%)
Kirrel2NP_766486.1 Ig 25..116 CDD:299845 24/110 (22%)
IG_like 27..116 CDD:214653 24/108 (22%)
I-set 123..221 CDD:254352 25/100 (25%)
Ig 138..220 CDD:299845 22/84 (26%)
Cell attachment site. {ECO:0000255} 146..148 1/2 (50%)
I-set 224..305 CDD:254352 17/81 (21%)
Ig_3 227..292 CDD:290638 12/65 (18%)
Ig 309..392 CDD:299845 7/29 (24%)
I-set 314..392 CDD:254352 7/24 (29%)
Ig 394..498 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.