DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and C3

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_058690.2 Gene:C3 RGDID:2232 Length:1663 Species:Rattus norvegicus

Alignment Length:595 Identity:117/596 (20%)
Similarity:189/596 (32%) Gaps:243/596 (41%)


  Fly     1 MLPPSWHLIGALLVLAATA----GDSTNKIILPQILNGGGGGGGV---GTAQGKHP--------- 49
            |.|.|...:..||:|.|::    |.....||.|.:|........:   ..|||..|         
  Rat     1 MGPTSGSQLLVLLLLLASSLLALGSPMYSIITPNVLRLESEETFILEAHDAQGDVPVTVTVQDFL 65

  Fly    50 -----SGSKTVATG----------------------------VVPNFGGAAGNGAGGGGPVAGSG 81
                 :..|||.||                            ||.||                  
  Rat    66 KKQVLTSEKTVLTGATGHLNRVSIKIPASKEFNADKGHKYVTVVANF------------------ 112

  Fly    82 TGSTVVGSNGVIVA--GGGANVPTSNLNIVVEEPEFTEY-----IENVTVPAGRNVKL------G 133
             |:||| ...|:|:  .|...:.|..   .:..|..|.:     ::|..:|.|:.|.:      |
  Rat   113 -GATVV-EKAVLVSFQSGYLFIQTDK---TIYTPGSTVFYRIFTVDNNLLPVGKTVVIVIETPDG 172

  Fly   134 CSVK-----------------------NLGSYKVA--WMHFEQ---SAILTVHNHVITRNPRISV 170
            ..:|                       |:|.:|:.  :.|..:   ||...|..:|:   |...|
  Rat   173 VPIKRDILSSHNQYGILPLSWNIPELVNMGQWKIRAFYEHAPKQTFSAEFEVKEYVL---PSFEV 234

  Fly   171 THDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGA 235
            ..:..::.  :|:      ::.:|..:    ::||:..:|       .|:|.:......:..|..
  Rat   235 LVEPTEKF--YYI------DDPKGLEV----SITARFLYG-------KNVDGTAFVIFGVQDEDK 280

  Fly   236 NISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPP 300
            .|||   |....|.:|    :|.|..|:                  :||.       :..:||.|
  Rat   281 KISL---AQSLTRVLI----EDGSGEAV------------------LSRK-------VLMDGVRP 313

  Fly   301 T-----VSKRIKVSVDF---------------PPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLN 345
            :     |.|.:.|||..               .|::..|:|:     .|..|.:.|..|.|..|.
  Rat   314 SSPEALVGKSLYVSVTVILHSGSDMVEAERSGIPIVTSPYQI-----HFTKTPKFFKPAMPFDLM 373

  Fly   346 YWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYV 410
            .:               |....|.||.:..:      |:.|.|.       ....:.||:.:|.|
  Rat   374 VF---------------VTNPDGSPARRVPV------VTQGSDA-------QALTQDDGVAKLSV 410

  Fly   411 SYP----PTTASSGIYSTDTHWGENGINNNYAYGGPD---STRSIYAQDKNTRYQSNLNEIGLSE 468
            :.|    |.|.:       ....:.||        ||   :||::.||..:|.:.|| |.:.||.
  Rat   411 NTPNNRQPLTIT-------VRTKKEGI--------PDARQATRTMQAQPYSTMHNSN-NYLHLSV 459

  Fly   469 QKSFLDKTQN 478
            .:..|....|
  Rat   460 SRVELKPGDN 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 21/130 (16%)
Ig 130..200 CDD:143165 15/104 (14%)
I-set 226..310 CDD:254352 19/89 (21%)
IGc2 233..298 CDD:197706 13/65 (20%)
Ig 313..410 CDD:299845 19/97 (20%)
IG_like 325..410 CDD:214653 16/85 (19%)
C3NP_058690.2 A2M_N 129..224 CDD:280081 15/98 (15%)
A2M_N_2 457..603 CDD:285005 4/14 (29%)
ANATO 678..747 CDD:237984
A2M 770..866 CDD:278630
complement_C3_C4_C5 996..1282 CDD:239226
A2M_comp 1051..1282 CDD:284982
A2M_recep 1398..1493 CDD:284981
Properdin-binding. {ECO:0000250} 1424..1456
NTR_complement_C3 1513..1661 CDD:239638
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.