DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Lrit3

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001274153.1 Gene:Lrit3 MGIID:2685267 Length:681 Species:Mus musculus

Alignment Length:488 Identity:100/489 (20%)
Similarity:174/489 (36%) Gaps:132/489 (27%)


  Fly    81 GTGSTVVGSNGVIVAGGGANVP--TSNLNI---VVEEPEFTEYIENVTVP----AGRNVKLGCSV 136
            |:||.:|..|.:.:....||.|  ||.|.|   ||.......:...|.:.    |..:|   .|:
Mouse    35 GSGSRLVLCNDLDMNEVPANFPVDTSKLRIEKTVVRRLPAEAFYYLVELQYLWLAYNSV---ASI 96

  Fly   137 KNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHE--EDRGRYMCQ 199
            :....|.:..:|     .|.:..:.:|..|.:|:....|  .||..||.|.:..  .:..||:..
Mouse    97 ETSSFYNLRQLH-----ELRLDGNSLTAFPWVSLLDMPH--LRTLDLHNNRIASVPNEAVRYLRN 154

  Fly   200 I-------NTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDD 257
            :       |.:|          .:||:..||.|...|......:.        .||.||...:| 
Mouse   155 LTCLDLSSNRLT----------TLPPDFLDSWSHLAVTPSRSPDF--------PPRRIILGLQD- 200

  Fly   258 NSRIAINKNHIVNEWEGD-----TLEITRISRLDMGAYL------CIASNGVPPTVSKRIKVSVD 311
                        |.|..|     .:|:::::  |....|      |.........:.:|:::...
Mouse   201 ------------NPWFCDCHISKVIELSKVT--DHAVVLLDPLMVCSEPERFQGILFQRVELEKC 251

  Fly   312 FPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEG-----PIIHDSHKYKVEATVGLPA 371
            ..|.:::....:.:..|.||.:.|..:.|||....|||.:|     .:|.:|....:..::    
Mouse   252 LKPSVMMSATKITSALGSNVLLRCDAKGHPTPQLTWTRSDGSTVNYTVIQESPGEGIRWSI---- 312

  Fly   372 YKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASS----------------- 419
                  :::.::|..|.|.|:|.|||..|.::.::.:.|....||..|                 
Mouse   313 ------ISLTSISHKDAGDYRCKAKNLAGISEAVVTVTVVGGVTTTLSPDSSERSPGEPPEQHPQ 371

  Fly   420 ----GIYSTDTHWGENGINNNYAYGGPDSTRSIY----------------AQDKNTRYQSNLNEI 464
                |.......|...|:.:..:|  |..:.::|                |....|..|::::  
Mouse   372 PGLGGSTPPSKSWLSPGLTSAPSY--PTPSAALYTSTWSPPPSSLPPIFSAASATTSVQTSIS-- 432

  Fly   465 GLSEQKSFLDKTQNPLLANGNANEADAESNGAR 497
            |.:.:.|.    |.|||..|..:.|..|.||.:
Mouse   433 GRTARTSH----QPPLLHPGGKSNAKIEKNGRK 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/109 (18%)
Ig 130..200 CDD:143165 16/72 (22%)
I-set 226..310 CDD:254352 14/95 (15%)
IGc2 233..298 CDD:197706 12/76 (16%)
Ig 313..410 CDD:299845 23/102 (23%)
IG_like 325..410 CDD:214653 22/90 (24%)
Lrit3NP_001274153.1 LRR 1. {ECO:0000255} 56..79 7/23 (30%)
LRR_8 61..117 CDD:290566 11/64 (17%)
LRR 2. {ECO:0000255} 80..103 5/26 (19%)
leucine-rich repeat 83..106 CDD:275378 4/26 (15%)
LRR 3. {ECO:0000255} 104..128 5/29 (17%)
LRR_8 105..165 CDD:290566 14/67 (21%)
LRR_4 106..146 CDD:289563 11/47 (23%)
leucine-rich repeat 107..130 CDD:275378 5/28 (18%)
LRR_4 129..170 CDD:289563 11/53 (21%)
LRR 4. {ECO:0000255} 129..151 7/24 (29%)
leucine-rich repeat 131..154 CDD:275378 7/23 (30%)
LRR 5. {ECO:0000255} 152..175 5/33 (15%)
leucine-rich repeat 155..168 CDD:275378 2/23 (9%)
Ig 254..335 CDD:299845 22/91 (24%)
IG_like 263..339 CDD:214653 22/86 (26%)
FN3 489..563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.